CLEC4C Fusion Protein

Catalog number: Ag12612
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

CLEC4C fusion protein Ag12612 SDS-PAGE


Product Name:
human CLEC4C-6*His fusion protein

Catalog No:
Ag12612

Source:
E. coli-derived, PET28a

Peptide Sequence:
MYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
(47-213aa encoded by BC074968)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top