EIF4EBP2 Fusion Protein

Catalog number: Ag8101
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

EIF4EBP2 fusion protein Ag8101 SDS-PAGE


Product Name:
human EIF4EBP2-GST fusion protein

Catalog No:
Ag8101

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
(1-120 aa encoded by BC005057)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top