LAMP3 Fusion Protein

Catalog number: Ag8294
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Powder

Please visit your regions distributor:


You can also
Request A Quote

Images See all

LAMP3 fusion protein Ag8294 SDS-PAGE


Product Name:
human LAMP3-6*His fusion protein

Catalog No:
Ag8294

Source:
E. coli-derived, PET28a

Peptide Sequence:
FPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDY
(30 - 380 aa encoded by BC032940)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Purity:
60%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Back
to top