MME,CD10 Fusion Protein

Catalog number: Ag12511
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

MME,CD10 fusion protein Ag12511 SDS-PAGE


Product Name:
human MME-6*His fusion protein

Catalog No:
Ag12511

Source:
E. coli-derived, PET28a

Peptide Sequence:
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSGMVARAYNPRGRRIA
(1-80aa encoded by BC106070)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top