Nectin 2 Polyclonal antibody

Nectin 2 Polyclonal Antibody for WB, ELISA
Cat No. 10100-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, 3T3-L1 cells, mouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10100-2-AP targets Nectin 2 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymonkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0149

Product name: Recombinant human Nectin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-269 aa of BC003091

Sequence: MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYD

Predict reactive species
Full Name poliovirus receptor-related 2 (herpesvirus entry mediator B)
Calculated Molecular Weight 58 kDa
GenBank Accession NumberBC003091
Gene Symbol Nectin-2/CD112
Gene ID (NCBI) 5819
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92692
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2, synonyms: HVEB, PRR2, CD112, PVRR2) is an adhesion molecule widely expressed in cell lines of different lineages, including hematopoietic, neuronal, endothelial and epithelial cells. CD112 belongs to a new family of immunoglobulin-like molecules that includes four members (CD111 , CD112, PRR3 and CD155) sharing an ectodomain made of three Ig domains, of V, C, C types. CD112 is expressed in the myelo-monocytic and megakaryocytic hematopoietic lineages and the function in hematopoiesis is currently unknown. CD112 is an intercellular homophilic adhesion. CD112 localizes specifically at adherents junctions via its cytoplasmic interaction with the scaffold F-actin binding protein afadin. This interaction is mediated by a sequence located to the C terminal ends of both isoforms of CD112 (A/ExYV) and the PDZ domain of afadin. This sequence is also found in CD112 and PRR3 and represents a specific consensus in the family, which is also named nectin family. Disruption of the murine CD112 gene leads to infertility of male mice with morphologically aberrant spermatozoa. CD112 mediates entry of some alphaherpesvirus mutants (also named HveB) via its V domain. CD112 is involved in cell to cell spreading of viruses

Publications

SpeciesApplicationTitle
monkeyWB,IF

Eur J Cell Biol

Membrane palmitoylated proteins regulate trafficking and processing of nectins.

Authors - Dudak Amanda A
Loading...
||
New chat

Able

正在加载,请稍候...