Filter:
  • Western Blot (WB) analysis of HEK293 cells using PCNA Polyclonal antibody (10205-2-AP)

    WB analysis of HEK293 cells using 10205-2-AP

    WB result of PCNA antibody (10205-2-AP, 1:10000) with si-control and si-PCNA transfected HEK293 cells.

  • Western Blot (WB) analysis of various lysates using PCNA Polyclonal antibody (10205-2-AP)

    WB analysis using 10205-2-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10205-2-AP (PCNA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using PCNA Polyclonal antibody (10205-2-AP)

    WB analysis using 10205-2-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10205-2-AP (PCNA antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using PCNA Polyclonal antibody (10205-2-AP)

    WB analysis using 10205-2-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10205-2-AP (PCNA antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of MCF-7 cells using PCNA Polyclonal antibody (10205-2-AP)

    IP experiment of MCF-7 using 10205-2-AP

    IP result of anti-PCNA (IP:10205-2-AP, 4ug; Detection:10205-2-AP 1:20000) with MCF-7 cells lysate 1880 ug.

  • Immunoprecipitation (IP) experiment of HeLa cells using PCNA Polyclonal antibody (10205-2-AP)

    IP experiment of HeLa using 10205-2-AP

    IP result of anti-PCNA (IP:10205-2-AP, 4ug; Detection:10205-2-AP 1:20000) with HeLa cells lysate 1200 ug.

  • Immunoprecipitation (IP) experiment using PCNA Polyclonal antibody (10205-2-AP)

    IP experiment using 10205-2-AP

    IP result of anti-PCNA (10205-2-AP for IP and Detection) with MCF7 cell.

  • Immunohistochemistry (IHC) staining of human stomach cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human stomach cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human breast cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human breast cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human liver cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human liver cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human stomach cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human stomach cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human malignant melanoma tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human malignant melanoma using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:200 (under 10x lens)..

  • Immunohistochemistry (IHC) staining of human malignant melanoma tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human malignant melanoma using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:200 (under 40x lens)..

  • Immunohistochemistry (IHC) staining of human liver cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human liver cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human liver cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human liver cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human colon cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IHC staining of human colon cancer using 10205-2-AP

    Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10205-2-AP (PCNA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of mouse testis tissue using PCNA Polyclonal antibody (10205-2-AP)

    IF Staining of mouse testis using 10205-2-AP

    Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PCNA antibody (10205-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of human breast cancer tissue using PCNA Polyclonal antibody (10205-2-AP)

    IF Staining of human breast cancer using 10205-2-AP

    Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using 10205-2-AP (PCNA antibody), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

"PCNA Antibodies" Comparison

View side-by-side comparison of PCNA antibodies from other vendors to find the one that best suits your research needs.
  • Featured Product
  • KD/KO Validated

PCNA Polyclonal antibody

The PCNA polyclonal antibody (10205-2-AP) is one of the most highly cited PCNA antibodies in the market. It is suitable for WB, IHC, IF-P, IP, ELISA and has been referenced in over 1,160 publications.
Cat No. 10205-2-AP
Publications(1160)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA, Cell treatment

Cyclin, proliferating cell nuclear antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A431 cells, BALB/3T3 clone A31 cells, HEK293 cells, Jurkat cells, MCF-7 cells, PC-12 cells, NIH/3T3 cells, C2C12 cells, mouse spleen tissue, rat spleen tissue
Positive IP detected inMCF-7 cells, HeLa cells
Positive IHC detected inhuman stomach cancer tissue, human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, human malignant melanoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue, human breast cancer tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1500-1:6000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10205-2-AP targets PCNA in WB, IHC, IF-P, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, chicken, goat, sheep, fish, ducks, medaka embryos
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0277

Product name: Recombinant human PCNA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 8-256 aa of BC000491

Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

Predict reactive species
Full Name proliferating cell nuclear antigen
Calculated Molecular Weight 29 kDa/31 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000491
Gene Symbol PCNA
Gene ID (NCBI) 5111
RRIDAB_2160330
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP12004
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. This antibody is a rabbit polyclonal antibody raised against an internal region of human PCNA. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).

Protocols

Product Specific Protocols
IF protocol for PCNA antibody 10205-2-APDownload protocol
IHC protocol for PCNA antibody 10205-2-APDownload protocol
IP protocol for PCNA antibody 10205-2-APDownload protocol
WB protocol for PCNA antibody 10205-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

J Hematol Oncol

METTL16 promotes liver cancer stem cell self-renewal via controlling ribosome biogenesis and mRNA translation

Authors - Meilin Xue
humanWB

Mil Med Res

Aspartoacylase suppresses prostate cancer progression by blocking LYN activation

Authors - Hong Weng
mouse,humanWB

Protein Cell

NDFIP1 limits cellular TAZ accumulation via exosomal sorting to inhibit NSCLC proliferation

Authors - Yirui Cheng
mouseIF

Brain Behav Immun

An enriched environment restores hepatitis B vaccination-mediated impairments in synaptic function through IFN-γ/Arginase1 signaling.

Authors - Fangfang Qi
humanWB,IF

Nat Commun

Selectively targeting the AdipoR2-CaM-CaMKII-NOS3 axis by SCM-198 as a rapid-acting therapy for advanced acute liver failure

Authors - Rui Wang
humanWB

Nat Commun

The RNA-binding protein LRPPRC promotes resistance to CDK4/6 inhibition in lung cancer

Authors - Wei Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

MALLIKARJUNA (Verified Customer) (10-14-2025)

GOOD FOR IF

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mouse tissue
FH

Mi (Verified Customer) (06-25-2023)

It works well in human brown adipocyte cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human brown adipocytes
FH

Emma (Verified Customer) (11-29-2021)

Nice antibody which worked well on PC3 cells fixed with 4% PFA. Antibody used at 1:50

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: PC3 cells
PCNA Antibody Immunofluorescence validation (1:50 dilution) in PC3 cells (Cat no:10205-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...