Beta Actin Polyclonal antibody

beta actin Polyclonal Antibody for ELISA
Cat No. 10230-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish and More (2)

Applications

WB, ELISA

ACTB, Actin, actin, beta, Actin, cytoplasmic 1, B actin, Beta actin, F actin, PS1TP5BP1, β actin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

WBSee 31 publications below

Product Information

10230-1-AP targets beta actin in WB, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0297

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-167 aa of BC002409

Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP60709
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Beta Actin has been widely used as the internal control in bioscience. At least six isoforms are known in mammals. ALPHA-actin was predominant in single cells and BETA-actin was major in the cultured cells. Nonmuscle BETA- and GAMMA-actin, also known as cytoplasmic actin, are predominantly expressed in nonmuscle cells. ALPHA-cardiac and α-skeletal actin are expressed in striated cardiac and skeletal muscles, respectively; two smooth muscle actins, ALPHA- and GAMMA-actin, are found primarily in vascular smooth muscle and enteric smooth muscle, respectively. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. This antibody can detect endogenous level of β-Actin and may cross-react with other isoforms of actin family.

Note: Do not add Azium (Sodium Azide or Smite) into the dilution buffer. Azium is the HRP inhibitor which decreases the enzyme activity of HRP.

Publications

SpeciesApplicationTitle
ratWB

Brief Bioinform

Mechanistic study of acupuncture on the pterygopalatine ganglion to improve allergic rhinitis: analysis of multi-target effects based on bioinformatics/network topology strategie

Authors - Meihui Tian
humanWB

Int J Nanomedicine

Integration of Dual Targeting and Dual Therapeutic Modules Endows Self-Assembled Nanoparticles with Anti-Tumor Growth and Metastasis Functions.

Authors - Biao Chen
pigWB

J Virol

Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin

Authors - Shujuan Zhang
WB

J Nat Prod

Ergone Derivatives from the Deep-Sea-Derived Fungus Aspergillus terreus YPGA10 and 25,28-Dihydroxyergone-Induced Apoptosis in Human Colon Cancer SW620 Cells

Authors - Zhen Zhang
humanWB

J Cell Biochem

Dependence of artesunate on long noncoding RNA-RP11 to inhibit epithelial-mesenchymal transition of hepatocellular carcinoma.

Authors - Wu Jing
bovineWB

Biol Trace Elem Res

The Protective Effect of Selenium on Bovine Mammary Epithelial Cell Injury Caused by Depression of Thioredoxin Reductase.

Authors - Yongmei Guo
Loading...
||
New chat

Able

正在加载,请稍候...