LSM1 Polyclonal antibody

LSM1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 10259-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Cancer associated Sm like, CASM, LSM1, Small nuclear ribonuclear CaSm, YJL124C

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse kidney tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10259-1-AP targets LSM1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0232

Product name: Recombinant human LSM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-133 aa of BC001767

Sequence: MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Predict reactive species
Full Name LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC001767
Gene Symbol LSM1
Gene ID (NCBI) 27257
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15116
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lsm1 is a component of the Lsm1-7 complex involved in cytoplasmic mRNA degradation. Lsm1 is a key subunit that determines the RNA-binding properties of this complex. The normal RNA-binding activity of this complex is crucial for mRNA decay and 3'-end protection in vivo and requires the intact Sm-domain of Lsm1. LSM1 localizes to cytoplasmic processing bodies (P bodies) involved in mRNA storage, processing, regulation, and degradation and is required for P-body formation. LSM1 proteins facilitate the formation of U4/U6 RNA duplexes in vitro and may play a role in U4/U6 snRNP formation.

Loading...
||
New chat

Able

正在加载,请稍候...