Tested Applications
| Positive WB detected in | U-251 cells, NIH/3T3 cells, U-87 MG cells, MDA-MB-231 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse stomach tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 197 publications below |
| IHC | See 41 publications below |
| IF | See 5 publications below |
Product Information
10371-2-AP targets MMP1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, rabbit, monkey, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0547 Product name: Recombinant human MMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC013875 Sequence: MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDED Predict reactive species |
| Full Name | matrix metallopeptidase 1 (interstitial collagenase) |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 45-48 kDa, 55-62 kDa |
| GenBank Accession Number | BC013875 |
| Gene Symbol | MMP1 |
| Gene ID (NCBI) | 4312 |
| RRID | AB_2297741 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P03956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP1, also named as CLG, belongs to the peptidase M10A family. MMP is the main enzyme that cleaves fibrillar collagen, namely types I, II, III, VII, and X.It is involved in cell migration and invasion, and is frequently up-regulated in cancer cells. It can be cleavage to two major forms (22 kDa and 27 kDa) by undergoing autolytic,and the minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.The sizes of pro-MMP-1 and active MMP-1 from human synovial fibroblasts have been reported as 52 to 56 kDa, depending on glycosylation, and 41 to 45 kDa, respectively.In addition ,a band of 62-kDa observed in the current study is pro-MMp-1(PMID:9418730).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP1 antibody 10371-2-AP | Download protocol |
| IHC protocol for MMP1 antibody 10371-2-AP | Download protocol |
| WB protocol for MMP1 antibody 10371-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Identification of TRA2B-DNAH5 fusion as a novel oncogenic driver in human lung squamous cell carcinoma. | ||
Biomaterials Material-driven immunomodulation and ECM remodeling reverse pulmonary fibrosis by local delivery of stem cell-laden microcapsules | ||
Biomaterials Macromechanics and polycaprolactone fiber organization drive macrophage polarization and regulate inflammatory activation of tendon in vitro and in vivo. | ||
Acta Biomater ROS-responsive magnesium-containing microspheres for antioxidative treatment of intervertebral disc degeneration | ||
Br J Cancer Chemerin suppresses hepatocellular carcinoma metastasis through CMKLR1-PTEN-Akt axis. | ||
Bioact Mater Injectable cartilage matrix hydrogel loaded with cartilage endplate stem cells engineered to release exosomes for non-invasive treatment of intervertebral disc degeneration. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Qi (Verified Customer) (02-03-2025) | This MMP1 antibody works well in multiple breast cancer cell lines with the dilution 1:1000.
![]() |
FH Saravanakumar (Verified Customer) (10-31-2017) | I highly recommencement this (MMP1) antibody works good for me in MCF10A breast normal epithelial cells.
|












