• Featured Product
  • KD/KO Validated

DLK1 Polyclonal antibody

DLK1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10636-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Pref 1, pG2, FA1, DLK-1, DLK 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse placenta tissue, mouse ovary tissue, 3T3-L1 cells, MCF-7 cells, A549 cells, mouse brain tissue
Positive IHC detected inhuman pancreas cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10636-1-AP targets DLK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0991

Product name: Recombinant human DLK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 83-383 aa of BC007741

Sequence: ELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI

Predict reactive species
Full Name delta-like 1 homolog (Drosophila)
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 45-60 kDa
GenBank Accession NumberBC007741
Gene Symbol DLK1
Gene ID (NCBI) 8788
RRIDAB_2092679
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP80370
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLK1, also named PREF1, FA1, or pG2, is a transmembrane protein belonging to the epidermal growth factor (EGF)-like superfamily (PMID: 8095043). It contains six EGF-like repeats in the extracellular region. DLK1 is abundant in preadipocytes and regulate adipocyte differentiation negatively (PMID: 8500166). Deficiency of DLK1 gives rise to growth retardation and accelerated adiposity in mouse model. Expression of DLK1 is found in tumors with neuroendocrine features that implies DLK1 may be involved in neuroendocrine differentiation (PMID: 8095043). It has been reported overexpression of DLK1 could lead to the development of metabolic abnormalities by impairment of adipocyte function in mice (PMID: 12588883). The gene of DLK1 maps to chromosome 14q32, and encodes a 383-amino acid protein with a calculated molecular mass of 41 kDa. In preadipocytes, multiple discrete forms of DLK1 protein of 45-60 kDa are present, owing in part to N-linked glycosylation (PMID: 8500166).

Protocols

Product Specific Protocols
IHC protocol for DLK1 antibody 10636-1-APDownload protocol
WB protocol for DLK1 antibody 10636-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Gastroenterology

Activation of β-catenin and Yap1 in human hepatoblastoma and induction of hepatocarcinogenesis in mice.

Authors - Junyan Tao
humanIHC

Nat Commun

GREB1 induced by Wnt signaling promotes development of hepatoblastoma by suppressing TGFβ signaling.

Authors - Shinji Matsumoto
mouseWB

PLoS Genet

Gene dosage effects of the imprinted delta-like homologue 1 (dlk1/pref1) in development: implications for the evolution of imprinting.

Authors - da Rocha Simao Teixeira ST
humanWB

Cell Death Differ

The miR-181d-regulated metalloproteinase Adamts1 enzymatically impairs adipogenesis via ECM remodeling.

Authors - S-Z Chen
pigIHC

Meat Sci

Dietary vitamin A restriction affects adipocyte differentiation and fatty acid composition of intramuscular fat in Iberian pigs.

Authors - M Ayuso
mouseIHC

Front Cell Dev Biol

A Na+/K+ ATPase Pump Regulates Chondrocyte Differentiation and Bone Length Variation in Mice.

Authors - Marta Marchini

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Angélique (Verified Customer) (12-04-2019)

Good specific signal without background staining in IHC on mouse liver and liver tumor sections.

  • Applications: Western Blot, Immunohistochemistry,
  • Primary Antibody Dilution: 1/100 in IHC, 1/500 in WB
  • Cell Tissue Type: mouse hepatocytes and liver tumours
DLK1 Antibody Western Blot,Immunohistochemistry, validation (1/100 in IHC, 1/500 in WB dilution) in mouse hepatocytes and liver tumours (Cat no:10636-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...