Home
Products
Primary Antibodies
Secretogranin V Polyclonal antibody (10761-1-AP)

Filter: AllWBIHCIF/ICC

WB analysis of mouse brain using 10761-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 10761-1-AP (Secretogranin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IHC staining of mouse pancreas using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse pancreas using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat pancreas using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat pancreas using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human pituitary adenoma using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human pituitary adenoma using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse pancreas using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse pancreas using 10761-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of PC-12 using 10761-1-AP
Immunofluorescent analysis of (10% Formaldehyde) fixed PC-12 cells using 10761-1-AP (Secretogranin V antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Secretogranin V Polyclonal antibody

Name: Secretogranin V Polyclonal antibody
Brand: Proteintech
SKU: 10761-1-AP

Secretogranin V Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 10761-1-AP

Publications(6)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SCG5, 7B2, C-terminal peptide, Neuroendocrine protein 7B2, N-terminal peptide

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (6)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	mouse pancreas tissue, human pituitary adenoma tissue, rat pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	PC-12 cells

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 5 publications below
IHC	See 2 publications below
IF	See 2 publications below

Product Information

10761-1-AP targets Secretogranin V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1107 Product name: Recombinant human SCG5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC005349 Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE Predict reactive species
Full Name	secretogranin V (7B2 protein)
Calculated Molecular Weight	24 kDa
GenBank Accession Number	BC005349
Gene Symbol	Secretogranin V
Gene ID (NCBI)	6447
RRID	AB_2183280
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P05408
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Secretogranin V (also known as SCG5, 7B2, or SGNE1) is a member of the granin family of acidic secretory proteins that plays an essential regulatory role in the neuroendocrine system. Its primary function is to act as both a chaperone and a specific inhibitor of prohormone convertase 2 (PC2), a key enzyme responsible for processing prohormones into bioactive hormones and neuropeptides. Secretogranin V facilitates the proper folding and transport of proPC2 through the secretory pathway and subsequently inhibits the enzymatic activity of mature PC2 to ensure precise hormone activation. In terms of expression, SCG5 is predominantly found in neuroendocrine tissues, including the pituitary gland, pancreas, adrenal medulla, and distinct regions of the central nervous system such as the cerebral cortex and cerebellum. Dysregulation of Secretogranin V has been linked to several human diseases, including diabetes, Cushing's disease, and certain neuroendocrine tumors, highlighting its clinical significance in hormone homeostasis

Protocols

Product Specific Protocols
IF protocol for Secretogranin V antibody 10761-1-AP	Download protocol
IHC protocol for Secretogranin V antibody 10761-1-AP	Download protocol
WB protocol for Secretogranin V antibody 10761-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Oncotarget Bromodomain protein BRD4 inhibitor JQ1 regulates potential prognostic molecules in advanced renal cell carcinoma. Authors - Takashi Sakaguchi View Article
human	WB	Am J Cancer Res The role of LRRC15-SCG5 in ECM protein binding as a prognostic signature for urothelial carcinoma Authors - Shao-Wei Dong KD Validated View Article
human	WB,IHC	Dis Esophagus Expression profile and function of secretogranin V, and its effects on the malignant behavior of esophageal squamous cell carcinoma Authors - Mohammad Hussain Hamrah KD Validated View Article
human	WB,IHC,IF	Sci Rep The potential of secretogranin V as a prognostic biomarker in non-small cell lung cancer Authors - Weisong Zhang View Article
mouse	IF	Diabetologia Transcriptomic heterogeneity of non-beta islet cells is associated with type 2 diabetes development in mouse models Authors - Pascal Gottmann View Article
mouse	WB	Aging (Albany NY) Plumbagin has an inhibitory effect on the growth of TSCC PDX model and it enhances the anticancer efficacy of cisplatin Authors - Yuqi Xin View Article