Tested Applications
| Positive WB detected in | HL-60 cells, mouse skeletal muscle tissue, HEK-293 cells, HeLa cells, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
Product Information
10779-1-AP targets TCEB2/Elongin-B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1228 Product name: Recombinant human TCEB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC013306 Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ Predict reactive species |
| Full Name | transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC013306 |
| Gene Symbol | TCEB2 |
| Gene ID (NCBI) | 6923 |
| RRID | AB_2240375 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15370 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex and is also reported to function as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes (PMID: 26531153). TCEB2 has 2 isoforms with the molecular mass of 13 and 18 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TCEB2/Elongin-B antibody 10779-1-AP | Download protocol |
| IP protocol for TCEB2/Elongin-B antibody 10779-1-AP | Download protocol |
| WB protocol for TCEB2/Elongin-B antibody 10779-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
Cell Death Differ CRL2-KLHDC3 E3 ubiquitin ligase complex suppresses ferroptosis through promoting p14ARF degradation. | ||
Cell Signal pVHL interacts with Ceramide kinase like (CERKL) protein and ubiquitinates it for oxygen dependent proteasomal degradation. | ||
bioRxiv The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Anna (Verified Customer) (02-05-2026) | Bands tend to be diffuse but are specific (no background or off-target bands). The best EloB antibody I or anyone in our lab has tried.
|
FH Abigail (Verified Customer) (12-16-2025) | Strong, clean signal with 5% NFM or 5% BSA in TBST at 1:500
|









