Tested Applications
| Positive WB detected in | mouse ovary tissue, human skeletal muscle tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IF | See 2 publications below |
Product Information
11411-2-AP targets COX7C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1989 Product name: Recombinant human COX7C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC007498 Sequence: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIIc |
| Calculated Molecular Weight | 63 aa, 7 kDa |
| Observed Molecular Weight | 15~28 kDa |
| GenBank Accession Number | BC007498 |
| Gene Symbol | COX7C |
| Gene ID (NCBI) | 1350 |
| RRID | AB_2085713 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15954 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. COX7C (Cytochrome c oxidase subunit 7C, mitochondrial) is one of the subunits, catalyzing the elctron transfer from reduced cytochrome c to molecule oxygen. This protein belongs to the cytochrome c oxidase VIIc family. The calculated molecular weight of COX7C is 7 kDa, but due to the presence of the complex, a complex form of 28 kDa may also be observed.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX7C antibody 11411-2-AP | Download protocol |
| IHC protocol for COX7C antibody 11411-2-AP | Download protocol |
| WB protocol for COX7C antibody 11411-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma. | ||
Cancer Sci Urea transport B gene induces melanoma B16 cell death via activation of p53 and mitochondrial apoptosis. | ||
J Neuropathol Exp Neurol Altered Mitochondria, Protein Synthesis Machinery, and Purine Metabolism Are Molecular Contributors to the Pathogenesis of Creutzfeldt-Jakob Disease. | ||
Front Pharmacol Effect of Dl-3-n-butylphthalide on mitochondrial Cox7c in models of cerebral ischemia/reperfusion injury
| ||
Cell Signal LncRNA LINC00667 inhibits breast cancer progression by regulating POTEE to suppress mitochondrial oxidative phosphorylation |







