Tested Applications
| Positive WB detected in | Jurkat cells, A375 cells, A549 cells, mouse brain tissue, rat skeletal muscle tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IP | See 1 publications below |
Product Information
11678-1-AP targets ARPP-19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2279 Product name: Recombinant human ARPP-19 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC003418 Sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG Predict reactive species |
| Full Name | cyclic AMP phosphoprotein, 19 kD |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC003418 |
| Gene Symbol | ARPP-19 |
| Gene ID (NCBI) | 10776 |
| RRID | AB_2060078 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56211 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARPP-19, a 19-kDa cAMP-regulated phosphoprotein, plays a role in regulating mitosis. Initiation and maintenance of mitosis require the activation of protein kinase cyclin B-Cdc2 and the inhibition of protein phosphatase 2A (PP2A). When phosphorylated by protein kinase Greatwall (Gwl), ARPP-19 associate with and inhibit PP2A, thus promoting mitotic entry. ARPP-19 may be an important link between nerve growth factor (NGF) signaling and post-transcriptional control of neuronal gene expression such as GAP-43.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| IF protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| IHC protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| IP protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Oncol Identification of Glycolysis-Related lncRNAs and the Novel lncRNA WAC-AS1 Promotes Glycolysis and Tumor Progression in Hepatocellular Carcinoma. | ||
J Proteome Res Phosphoproteome Profiling Revealed the Importance of mTOR Inhibition on CDK1 Activation to Further Regulate Cell Cycle Progression. | ||
Cancers (Basel) Arpp19 Promotes Myc and Cip2a Expression and Associates with Patient Relapse in Acute Myeloid Leukemia.
| ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sai Sindhura (Verified Customer) (01-08-2026) | VERY GOOD ANTIBODY
|
FH Iram (Verified Customer) (01-15-2021) | ARPP19 antibody giving a very clear sharp bands
|

















