• Featured Product
  • KD/KO Validated

Galc Polyclonal antibody

Galc Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA
Cat No. 11991-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

EC:3.2.1.46, Gacy, Galactocerebrosidase, Galactocerebroside beta-galactosidase, Galactosylceramide beta-galactosidase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, A549 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IP detected inNIH/3T3 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11991-1-AP targets Galc in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3914

Product name: Recombinant mouse Galc protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 340-513 aa of BC086671

Sequence: YYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTL

Predict reactive species
Full Name galactosylceramidase
Calculated Molecular Weight 77 kDa
Observed Molecular Weight 80 kDa, 30 kDa, 50 kDa
GenBank Accession NumberBC086671
Gene Symbol Galc
Gene ID (NCBI) 14420
RRIDAB_10641987
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP54818
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The GALC antibody targets the liposomal enzyme Galactosylceramidase (GALC), which belongs to the glycosyl hydrolase 59 family. It hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. It is primarily found in the brain and kidneys where galactolipids are hydrolyzed (PMID:8634707). Deficiencies of GALC are primarily associated with the autosomal recessive Krabbe's disease. This disease is characterized by developmental delay caused by apoptosis of myelin-forming cells. GALC is responsible for hydrolyzing galactosylceramide, a cerebroside that is an important component of myelin. A deficiency in GALC causes loss of myelin to nerve cells, resulting in delayed nerve transmissions. Krabbe's disease has varying degrees of severity due to a large number of different genetic mutations in the gene. The GALC antibody can be used to detect the deletions in the GALC gene and functions of the enzyme (PMID:20886637). Normal GALC mRNA encodes the 80 kDa precursor, which is processed into 50 and 30 kDa subunits (PMID: 26865610).

Protocols

Product Specific Protocols
IF protocol for Galc antibody 11991-1-APDownload protocol
IHC protocol for Galc antibody 11991-1-APDownload protocol
IP protocol for Galc antibody 11991-1-APDownload protocol
WB protocol for Galc antibody 11991-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Dev Cell

NPC1-mTORC1 Signaling Couples Cholesterol Sensing to Organelle Homeostasis and Is a Targetable Pathway in Niemann-Pick Type C.

Authors - Oliver B Davis
mouseWB

Stem Cells

Multipotent Stromal Cells Alleviate Inflammation, Neuropathology, and Symptoms Associated with Globoid Cell Leukodystrophy in the Twitcher Mouse.

Authors - Scruggs Brittni A BA
human,mouseIF

Stem Cell Res Ther

Enhanced neuromorphogenesis of neural stem cells via the optimization of physical stimulus-responsive signaling pathways

Authors - Youyi Tai
mouseIHC

Mol Ther

Extended normal life after AAVrh10-mediated gene therapy in the mouse model of Krabbe disease.

Authors - Rafi Mohammad A MA
mouseIHC

Mol Ther

AAV-mediated expression of galactocerebrosidase in brain results in attenuated symptoms and extended life span in murine models of globoid cell leukodystrophy.

Authors - Rafi Mohammad A MA

Glia

Ncx3 gene ablation impairs oligodendrocyte precursor response and increases susceptibility to experimental autoimmune encephalomyelitis.

Authors - Antonella Casamassa

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Celia (Verified Customer) (01-14-2025)

Antibody worked well, arrived promptly and the team were really helpful getting the order sorted with my university.

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...