• Featured Product
  • KD/KO Validated

CXCL1 Polyclonal antibody

CXCL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12335-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA, Cell treatment

C X C motif chemokine 1, C-X-C motif chemokine 1, CXCL 1, GRO-alpha(4-73), GRO-alpha(5-73)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLPS and Protein transport inhibitor treated HUVEC cells
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12335-1-AP targets CXCL1 in WB, IHC, IF, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2917

Product name: Recombinant human CXCL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-107 aa of BC011976

Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
Calculated Molecular Weight 8 kDa to 14 kDa
Observed Molecular Weight12 kDa
GenBank Accession NumberBC011976
Gene Symbol CXCL1
Gene ID (NCBI) 2919
RRIDAB_2087568
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09341
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.

Protocols

Product Specific Protocols
IHC protocol for CXCL1 antibody 12335-1-APDownload protocol
WB protocol for CXCL1 antibody 12335-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Signal Transduct Target Ther

Aberrant Notch-signaling promotes tumor angiogenesis in esophageal squamous-cell carcinoma

Authors - Cainan Li
humanWB

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
IHC

Cell Host Microbe

Induction of bone loss by pathobiont-mediated Nod1 signaling in the oral cavity.

Authors - Jiao Yizu Y
humanIHC

J Exp Med

An adaptive signaling network in melanoma inflammatory niches confers tolerance to MAPK signaling inhibition.

Authors - Helen L Young

Cell Death Dis

Unraveling the Role of METTL3 in Helicobacter pylori-induced gastritis via m6A-CXCL1/NF-κB modulation

Authors - Qiutong Lu
humanWB,IF

Cell Rep

Collagen 1-mediated CXCL1 secretion in tumor cells activates fibroblasts to promote radioresistance of esophageal cancer

Authors - Xinyu Yang
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...