Tested Applications
| Positive WB detected in | mouse pancreas tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 6 publications below |
| IF | See 10 publications below |
Product Information
12540-1-AP targets Amylase Alpha in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3260 Product name: Recombinant human AMY2B protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 160-511 aa of BC011179 Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species |
| Full Name | amylase, alpha 2B (pancreatic) |
| Calculated Molecular Weight | 511 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC011179 |
| Gene Symbol | AMY2B |
| Gene ID (NCBI) | 280 |
| RRID | AB_2273990 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19961 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. The full length 58 kDa protein has a signal peptide with 15 amino acids. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). 12540-1-AP can recognize both AMY2A and AMY2B.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| IHC protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| WB protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Inflammation and Acinar Cell Dual-Targeting Nanomedicines for Synergistic Treatment of Acute Pancreatitis via Ca2+ Homeostasis Regulation and Pancreas Autodigestion Inhibition | ||
Cancer Lett SULF2 enhances GDF15-SMAD axis to facilitate the initiation and progression of pancreatic cancer. | ||
Biochim Biophys Acta Mol Basis Dis Pyrazole derivative Z10 ameliorates acute pancreatitis by inhibiting the ERK/Ddt pathway | ||
Int Immunopharmacol Gastrodin ameliorates acute pancreatitis by modulating macrophage inflammation cascade via inhibition the p38/NF-κB pathway | ||
Mol Biol Cell Vacuolization of mucolipidosis type II mouse exocrine gland cells represents accumulation of autolysosomes. | ||
Biomed Pharmacother Serotonin-RhoA/ROCK axis promotes acinar-to-ductal metaplasia in caerulein-induced chronic pancreatitis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sai Sindhura (Verified Customer) (01-08-2026) | Amylase antibody worked very good.
|
FH Mounika (Verified Customer) (01-08-2026) | Wonderful antibodies , easy to work with !
|
FH Mounika (Verified Customer) (01-08-2026) | Best and easy to work with, No Hassale!
|
FH Gabriele (Verified Customer) (07-18-2025) | The antibody works very well both in WB (1:5000, 5% milk) and IF (1:200, 5% BSA) on HEK293T over-expressing human AMY2A 48h post-transfection vs not-treated control
![]() |
FH balawant (Verified Customer) (08-06-2022) | This antibody is working great and need 1:20000 dilution.
|
FH Susmita (Verified Customer) (06-13-2022) | This is an excellent antibody for IHC and WB application
|
FH Iram (Verified Customer) (03-11-2022) | Very good antibody for western
|








