GRK3 Polyclonal antibody

GRK3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 13727-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

G protein-coupled receptor kinase 3, EC:2.7.11.15, Beta-ARK-2, Beta-adrenergic receptor kinase 2, ADRBK2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, HL-60 cells
Positive IHC detected inmouse brain tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13727-1-AP targets GRK3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4685

Product name: Recombinant human ADRBK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-387 aa of BC036797

Sequence: MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRG

Predict reactive species
Full Name adrenergic, beta, receptor kinase 2
Calculated Molecular Weight 688 aa, 80 kDa
Observed Molecular Weight 70 kDa, 90 kDa
GenBank Accession NumberBC036797
Gene Symbol GRK3
Gene ID (NCBI) 157
RRIDAB_2225851
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35626
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRK3 (G protein coupled receptor kinase 3), also known as ADRBK2 or BARK2, belongs to the G protein coupled receptor kinases (GRKs) family. GRKs are serine/threonine kinases that regulate a large and diverse class of G-protein coupled receptors (GPCRs). GRKs have been shown to play a critical role in the outcome of a variety of physiological and pathophysiological processes including chemotaxis, signaling, migration, inflammatory gene expression and so on (PMID: 28950947, 29483837). GRK3 was identified as a negative regulator of CXCL12/CXCR4 signaling, and has also been shown to be overexpressed in human prostate cancer and found to promote tumor growth and metastasis by enhancing angiogenesis (PMID: 23935208, 24434559). GRK3 has a molecular mass of 75-80 kDa, and also can be ubiquitinated (PMID: 20596523).

Protocols

Product Specific Protocols
IHC protocol for GRK3 antibody 13727-1-APDownload protocol
WB protocol for GRK3 antibody 13727-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...