Tested Applications
| Positive WB detected in | HeLa cells, ARPE-19 cells, Jurkat cells, K-562 cell |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human retinoblastoma tissue, human gliomas tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 15 publications below |
| WB | See 58 publications below |
| IHC | See 14 publications below |
| IF | See 3 publications below |
Product Information
14681-1-AP targets ASNS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6393 Product name: Recombinant human ASNS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 247-561 aa of BC014621 Sequence: LMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA Predict reactive species |
| Full Name | asparagine synthetase |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 55-64 kDa |
| GenBank Accession Number | BC014621 |
| Gene Symbol | ASNS |
| Gene ID (NCBI) | 440 |
| RRID | AB_2060119 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08243 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Asparagine synthetase [glutamine-hydrolyzing](ASNS) is also named as TS11. The asparagine synthetase gene, encoding the enzyme that catalyzes the synthesis of asparagine and glutamate using glutamine and aspartate, is a gene for which transcription is highly regulated by the nutritional status of the cell(PMID:15385533). ASNS has some isoforms with the MW of 55-64 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ASNS antibody 14681-1-AP | Download protocol |
| IHC protocol for ASNS antibody 14681-1-AP | Download protocol |
| IP protocol for ASNS antibody 14681-1-AP | Download protocol |
| WB protocol for ASNS antibody 14681-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab ZBTB1 Regulates Asparagine Synthesis and Leukemia Cell Response to L-Asparaginase. | ||
Cell Metab Asparagine couples mitochondrial respiration to ATF4 activity and tumor growth.
| ||
Mol Cell Asparagine sensing by TBK1 controls its phase separation to drive antiviral innate immune responses | ||
Mol Cell Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.
| ||
Mol Cell Asparagine plays a critical role in regulating cellular adaptation to glutamine depletion.
| ||
Nat Commun p53-mediated control of aspartate-asparagine homeostasis dictates LKB1 activity and modulates cell survival.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Samuel (Verified Customer) (02-16-2026) | Overall, I found this primary antibody to serve my Western blotting needs quite well, however at a dilution that is a bit more concentrated, (1:1000), compared to what is recommended on the product description, (1:2000-1:10000). I initially tried Western blotting using a concentration of 1:2500 and I was able to obtain bands while imaging, however they were a little too faint and the imaging exposure time was a bit longer than I was anticipating. That being said, however, the results I ultimately ended up with were very much to my liking and as a result, I would highly recommend this antibody for Western blotting purposes, (it might just take a bit of trial and error for the ideal primary antibody concentration to be determined for each respective lysate sample set). I have not yet performed IHC using this antibody for my own experimental purposes, but intend to do so in the future. The primary antibody dilutions recommended for IHC on the product description are more or less aligned with what I am accustomed to from an IHC perspective, so I anticipate good results by using this primary antibody given the positive outcome from my Western blotting experiments. Overall, great antibody and would recommend.
|
FH Daniel (Verified Customer) (12-02-2019) | Human RCC4 kidney cancer cell lysate was denatured in SDS-sample buffer and size-separated on a denaturing gel.A specific band appeared for ASNS.
 |
FH Daniel (Verified Customer) (12-02-2019) | Mouse kidney stained for Asns (green, AF488) and nucleus (blue, DAPI).
 |
