• Featured Product
  • KD/KO Validated

LEF1 Polyclonal antibody

LEF1 Polyclonal Antibody for WB, IP, ELISA
Cat No. 14972-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, ELISA

LEF 1, LEF1, TCF1 alpha, TCF1ALPHA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, COLO 320 cells, NCCIT cells
Positive IP detected inSW 1990 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14972-1-AP targets LEF1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6882

Product name: Recombinant human LEF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-399 aa of BC050632

Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI

Predict reactive species
Full Name lymphoid enhancer-binding factor 1
Calculated Molecular Weight 37 kDa
Observed Molecular Weight50-55 kDa, 65 kDa
GenBank Accession NumberBC050632
Gene Symbol LEF1
Gene ID (NCBI) 51176
ENSEMBL Gene IDENSG00000138795
RRIDAB_2265677
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UJU2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphoid enhancer-binding factor 1(LEF1) belongs to a family of regulatory proteins that share homology with high mobility group protein-1, and it's a nuclear protein expressed in pre-B and T cells. LEF1 has a role in the Wnt signaling pathway hair cell differentiation and follicle morphogenesis. Together with CTNNB1 and EP300, LEF1 activates transcription of target genes. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances the proliferation of pancreatic tumor cells. MECs can give rise to seven cell types of the SAE and SMGs following severe airway injury. MECs progressively adopted a basal cell phenotype on the SAE and established lasting progenitors capable of further regeneration following reinjury. MECs activate Wnt-regulated transcription factors (Lef-1/TCF7) following injury and Lef-1 induction in cultured MECs promotes transition to a basal cell phenotype. Surprisingly, dose-dependent MEC conditional activation of Lef-1in vivopromoted self-limited airway regeneration in the absence of injury. Thus, modulating the Lef-1 transcriptional program in MEC-derived progenitors may have regenerative medicine applications for lung diseases. (https://doi.org/10.1016/j.stem.2018.03.017) The phosphorylation may affect the LEF1 protein's theoretical molecular weight when tested.40-70 kD bands have also been reported (PMID: 22261717; 17063141 ).

Protocols

Product Specific Protocols
IP protocol for LEF1 antibody 14972-1-APDownload protocol
WB protocol for LEF1 antibody 14972-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Mol Immunol

TRIM27 maintains gut homeostasis by promoting intestinal stem cell self-renewal

Authors - Jing Wang
mouseWB,IF

J Allergy Clin Immunol

Dedicator of cytokinesis protein 2 couples with lymphoid enhancer-binding factor 1 to regulate expression of CD21 and B-cell differentiation.

Authors - Yukai Jing
mouseWB

Cell Death Differ

MACF1 promotes osteoblast differentiation by sequestering repressors in cytoplasm.

Authors - Lifang Hu
humanWB

Clin Cancer Res

microRNA-221 Enhances MYCN via Targeting Nemo-like Kinase and Functions as an Oncogene Related to Poor Prognosis in Neuroblastoma.

Authors - Xiao-Yan He
humanWB

Cancer Lett

TIMELESS confers cisplatin resistance in nasopharyngeal carcinoma by activating the Wnt/β-catenin signaling pathway and promoting the epithelial mesenchymal transition.

Authors - Sai-Lan Liu
  • KD Validated
humanWB

Oncogene

β-Catenin interacts with canonical RBPs including MSI2 to associate with a Wnt signalling mRNA network in myeloid leukaemia cells

Authors - M Wagstaff
Loading...
||
New chat

Able

正在加载,请稍候...