Tested Applications
| Positive WB detected in | HepG2 cells, human liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IF | See 1 publications below |
Product Information
14975-1-AP targets UQCRQ in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6886 Product name: Recombinant human UQCRQ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001390 Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK Predict reactive species |
| Full Name | ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001390 |
| Gene Symbol | UQCRQ |
| Gene ID (NCBI) | 27089 |
| RRID | AB_2288356 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14949 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain. The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| IHC protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| IP protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| WB protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Deficiency of T-Cell Intracellular Antigen 1 in Murine Embryonic Fibroblasts Is Associated with Changes in Mitochondrial Morphology and Respiration. | ||
Stem Cells The Transcription Factor 7-Like 2-Peroxisome Proliferator-Activated Receptor Gamma Coactivator-1 Alpha Axis Connects Mitochondrial Biogenesis and Metabolic Shift with Stem Cell Commitment to Hepatic Differentiation. | ||
Cell Death Dis Calcium sensing receptor protects high glucose-induced energy metabolism disorder via blocking gp78-ubiquitin proteasome pathway. | ||
J Biol Chem Mitochondrial reactive oxygen species regulate transforming growth factor-β signaling.
| ||
Am J Physiol Endocrinol Metab Exogenous H2S reduces acetylation levels of mitochondrial respiratory enzymes via regulating NAD+-SIRT3 pathway in cardiac tissues of db/db mice. | ||
Front Endocrinol (Lausanne) The Impaired Bioenergetics of Diabetic Cardiac Microvascular Endothelial Cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Annabel (Verified Customer) (12-23-2025) | Produces a single band and strong signal. Imaged using blotting accelerator
![]() |


















