Tested Applications
| Positive WB detected in | Tunicamycin treated HeLa cells, MCF-7 cells, HeLa cells, K-562 cells, RAW 264.7 cells |
| Positive IP detected in | C6 cells |
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue, human thyroid cancer tissue, human cervical cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Tunicamycin treated HeLa cells |
| Positive FC (Intra) detected in | Tunicamycin treated HeLa cells |
Samples need to be treated with ER stress.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 24 publications below |
| WB | See 638 publications below |
| IHC | See 84 publications below |
| IF | See 83 publications below |
| IP | See 4 publications below |
| CoIP | See 1 publications below |
| ChIP | See 2 publications below |
Product Information
15204-1-AP targets CHOP/GADD153 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species |
| Full Name | DNA-damage-inducible transcript 3 |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC003637 |
| Gene Symbol | CHOP |
| Gene ID (NCBI) | 1649 |
| RRID | AB_2292610 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35638 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| IHC protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| IP protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| WB protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Immunol Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity. | ||
Mol Cell Mitochondrial DNA breaks activate an integrated stress response to reestablish homeostasis | ||
Mol Cell The FUS::DDIT3 fusion oncoprotein inhibits BAF complex targeting and activity in myxoid liposarcoma. | ||
Mol Cell Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis. | ||
Acta Pharm Sin B Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Danyan (Verified Customer) (10-02-2025) | Performed as expected, with high sensitivity and low background across multiple applications.
|
FH Morgane (Verified Customer) (09-15-2025) | Very specific, good signal, stress inductible
![]() |
FH Fan (Verified Customer) (03-22-2021) | Mouse retinal tissue was used. Single band detected at the right size.
![]() |
FH Daniel (Verified Customer) (06-25-2019) | Specific staining detected in the proximal tubules.
![]() |










































