• Featured Product
  • KD/KO Validated

FXYD6 Polyclonal antibody

FXYD6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 15805-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

FXYD domain-containing ion transport regulator 6, Phosphohippolin, UNQ521/PRO1056

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-12 cells, COLO 320 cells, human brain tissue, human testis tissue, mouse brain tissue, rat brain tissue, SH-SY5Y cells
Positive IHC detected inrat brain tissue, human brain tissue, human liver tissue, human ovary tissue, human skin tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15805-1-AP targets FXYD6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8538

Product name: Recombinant human FXYD6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-95 aa of BC018652

Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

Predict reactive species
Full Name FXYD domain containing ion transport regulator 6
Calculated Molecular Weight 95 aa, 11 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC018652
Gene Symbol FXYD6
Gene ID (NCBI) 53826
RRIDAB_2108625
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H0Q3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia.

Protocols

Product Specific Protocols
IF protocol for FXYD6 antibody 15805-1-APDownload protocol
IHC protocol for FXYD6 antibody 15805-1-APDownload protocol
WB protocol for FXYD6 antibody 15805-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

J Am Soc Nephrol

Single-Cell RNA Sequencing Reveals Renal Endothelium Heterogeneity and Metabolic Adaptation to Water Deprivation.

Authors - Sébastien J Dumas
humanWB,IF

Cancer Med

Identification of FXYD6 as the novel biomarker for glioma based on differential expression and DNA methylation

Authors - Weiliang Hou
humanWB

Biomed Res Int

FXYD6 Regulates Chemosensitivity by Mediating the Expression of Na+/K+-ATPase α1 and Affecting Cell Autophagy and Apoptosis in Colorectal Cancer.

Authors - Wen Luo
  • KD Validated
humanWB

Front Immunol

Identification of prognostic subtypes and the role of FXYD6 in ovarian cancer through multi-omics clustering

Authors - Boyi Ma
Loading...
||
New chat

Able

正在加载,请稍候...