CD3 Delta Polyclonal antibody

CD3 Delta Polyclonal Antibody for WB, IF-P, IP, ELISA
Cat No. 16669-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

CD3D, T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, T3D, T cell receptor T3 delta chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, mouse thymus tissue, rat thymus tissue, MOLT-4 cells
Positive IP detected inJurkat cells
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16669-1-AP targets CD3 Delta in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10148

Product name: Recombinant human CD3D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-171 aa of BC070321

Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

Predict reactive species
Full Name CD3d molecule, delta (CD3-TCR complex)
Calculated Molecular Weight 171 aa, 19 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC070321
Gene Symbol CD3 Delta
Gene ID (NCBI) 915
RRIDAB_10598004
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04234
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.

Protocols

Product Specific Protocols
IF protocol for CD3 Delta antibody 16669-1-APDownload protocol
IP protocol for CD3 Delta antibody 16669-1-APDownload protocol
WB protocol for CD3 Delta antibody 16669-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Cancer Res

Epigenetic regulation of CXCL12 plays a critical role in mediating tumor progression and the immune response in osteosarcoma.

Authors - Binghao Li
mouseIHC

J Nanobiotechnology

Oxygen-delivery nanoparticles enhanced immunotherapy efficacy monitored by granzyme B PET imaging in malignant tumors

Authors - Xingyi Wang

Clin Cancer Res

Changes in Expression of Genes Representing Key Biologic Processes after Neoadjuvant Chemotherapy in Breast Cancer, and Prognostic Implications in Residual Disease.

Authors - Marie Klintman
mouseIF

Inflamm Regen

Testosterone upregulates glial cell line-derived neurotrophic factor (GDNF) and promotes neuroinflammation to enhance glioma cell survival and proliferation

Authors - Kouminin Kanwore
humanIHC

Ann Diagn Pathol

Diagnostic utility of the aberrant immunohistochemical expression of CD3 molecules for peripheral T-cell lymphomas.

Authors - Tsugumi Satoh

Int J Biol Macromol

A novel FITC.Chimeric antigen receptor-T cell targeting HIV-1-infected cells with FITC-conjugated antibodies for enhanced cytotoxicity

Authors - Zhizhong Mi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Anja (Verified Customer) (12-22-2023)

The antibody was tested for western blot but only showed unspecific results. Also comparison to validated negative controls did not indicate any specificity in our hands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Thymocytes and T cells
CD3 Delta Antibody Western Blot validation (1:1000 dilution) in Thymocytes and T cells (Cat no:16669-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...