Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
Product Information
16797-1-AP targets LITAF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10269 Product name: Recombinant human LITAF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC008309 Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC Predict reactive species |
| Full Name | lipopolysaccharide-induced TNF factor |
| Calculated Molecular Weight | 161 aa, 17 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC008309 |
| Gene Symbol | LITAF |
| Gene ID (NCBI) | 9516 |
| RRID | AB_2135710 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99732 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LITAF antibody 16797-1-AP | Download protocol |
| IHC protocol for LITAF antibody 16797-1-AP | Download protocol |
| IP protocol for LITAF antibody 16797-1-AP | Download protocol |
| WB protocol for LITAF antibody 16797-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mol Neurobiol LITAF Enhances Radiosensitivity of Human Glioma Cells via the FoxO1 Pathway.
| ||
Poult Sci PRIAM1 participates in the inhibition of inflammation and acetylcholinesterase activity in goose fatty liver formation | ||
Nat Commun Single cell transcriptomic analyses implicate an immunosuppressive tumor microenvironment in pancreatic cancer liver metastasis |



















