Tested Applications
| Positive WB detected in | MCF7 cells, HeLa cells, Jurkat cells, mouse liver tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | human testis tissue, human brain tissue, human kidney tissue, human pancreas tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
17725-1-AP targets ATP6V1F in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species |
| Full Name | ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F |
| Calculated Molecular Weight | 119 aa, 13 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC107854 |
| Gene Symbol | ATP6V1F |
| Gene ID (NCBI) | 9296 |
| RRID | AB_2062680 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16864 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ATP6V1F antibody 17725-1-AP | Download protocol |
| WB protocol for ATP6V1F antibody 17725-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Trace Elem Med Biol Study on the mechanism of arsenic-induced renal injury based on SWATH proteomics technology | ||
BMC Med Genomics ATP6V1F is a novel prognostic biomarker and potential immunotherapy target for hepatocellular carcinoma | ||
Front Oncol Genome-wide association studies identify miRNA-194 as a prognostic biomarker for gastrointestinal cancer by targeting ATP6V1F, PPP1R14B, BTF3L4 and SLC7A5 | ||
Nat Struct Mol Biol A heterotrimeric protein complex assembles the metazoan V-ATPase upon dissipation of proton gradients | ||
J Proteome Res Proteomic Investigation of Differential Interactomes of Glypican 1 and a Putative Disease-Modifying Variant of Ataxia |





























