PPIF Polyclonal antibody

PPIF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 18466-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

PPIF-Specific, Cyclophilin D, Cyclophilin F, Cyp D, CyP-D

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, human heart tissue, rat heart tissue, mouse heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18466-1-AP targets PPIF in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13151

Product name: Recombinant human PPIF-Specific protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-207 aa of BC005020

Sequence: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

Predict reactive species
Full Name peptidylprolyl isomerase F
Calculated Molecular Weight 22 kDa
Observed Molecular Weight16~22 kDa
GenBank Accession NumberBC005020
Gene Symbol PPIF
Gene ID (NCBI) 10105
RRIDAB_2169273
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP30405
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPIF, also named as Cyclophilin D (CypD), CYP3, PPIase F and Rotamase F, belongs to the cyclophilin-type PPIase family. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIF is a mitochondrial matrix protein involved in the induction of necrotic and apoptotic cell death through the activation of the mitochondrial permeability transition (mPT) pore. This antibody is immunized with full length gene PPIF and absorbed by PPIA. So this antibody is specific to PPIF.

Protocols

Product Specific Protocols
IF protocol for PPIF antibody 18466-1-APDownload protocol
IHC protocol for PPIF antibody 18466-1-APDownload protocol
IP protocol for PPIF antibody 18466-1-APDownload protocol
WB protocol for PPIF antibody 18466-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Commun

The mitochondrial fusion protein OPA1 is dispensable in the liver and its absence induces mitohormesis to protect liver from drug-induced injury

Authors - Hakjoo Lee
humanIHC

Aging (Albany NY)

Overexpression of TICRR and PPIF confer poor prognosis in endometrial cancer identified by gene co-expression network analysis.

Authors - Linlin Yang
mouseWB

J Biol Chem

The short variant of optic atrophy 1 (OPA1) improves cell survival under oxidative stress.

Authors - Hakjoo Lee
humanIF

PLoS One

Genome-Wide Analysis Reveals Coating of the Mitochondrial Genome by TFAM.

Authors - Wang Yun E YE
mouse,humanWB,CoIP

Cell Signal

Diminution of HSP75 disrupts intestinal epithelial barrier by inciting mPTP opening in ulcerative colitis

Authors - Hao Liang

Cell Signal

LncRNA LINC00667 inhibits breast cancer progression by regulating POTEE to suppress mitochondrial oxidative phosphorylation

Authors - Zhengling Yu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Samuel (Verified Customer) (10-29-2025)

After having used an anti-PPIF primary antibody from two competing vendors for Western Blot analyses, both at a dilution of 1:750, I can say with confidence that the Proteintech anti-PPIF antibody works a lot better when taking into consideration the sharpness of the protein bands observed during Western Blot imaging, the relative lack of non-specific binding, and the fact that all of this was achieved at a primary antibody dilution of 1:1000 rather than 1:750, making the product not only higher quality when compared to competitors, but also more cost effective in the long run. I have been able to re-use the same primary antibody solution for four different Western Blot experiments and there is little to no reduction in band quality. I have also used this specific antibody for one IHC experiment, which yielded results that were very much to my liking, primarily as a result of the signal intensity, which I would rate above average compared to competitors. All this being said, I would highly recommend this specific antibody for anyone who is considering using it for great results, at least from a Western Blot and IHC perspective.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Cells
FH

Veronica (Verified Customer) (01-30-2024)

Really satisfied with the result in WB. No aspecific signal, clear band. Reccomended! Conditions: 12% acrylammide gel Ab’: 1:2000 in 5% milk O/N

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HeLa
PPIF Antibody Western Blot validation (1:2000 dilution) in HeLa (Cat no:18466-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...