CIRBP Monoclonal antibody

CIRBP Monoclonal Antibody for ELISA
Cat No. 60025-2-Ig
Clone No.4D12H7

Host / Isotype

Mouse / IgM

Reactivity

human, mouse

Applications

IHC, ELISA

CIRBP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

IHCSee 1 publications below

Product Information

60025-2-Ig targets CIRBP in IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0280

Product name: Recombinant human CIRBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-172 aa of BC000403

Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Predict reactive species
Full Name cold inducible RNA binding protein
Calculated Molecular Weight 172 aa, 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC000403
Gene Symbol CIRBP
Gene ID (NCBI) 1153
Conjugate Unconjugated
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDQ14011
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CIRBP, also named as A18HNRNP and CIRP, is a cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. CIRBP is also involved in cap-independent translation upon moderate cold-shock. It acts as a translational activator. CIRBP is a suppressive rather stimulatory effect on proliferation. It acts as a translational repressor. CIRBP is an immortalized gene in murine primary cells. CIRBP promotes assembly of stress granules (SGs), when overexpressed. It is a potential proto-oncogenic proteins upon overexpression.(PMID:19900510) Suppression of CIRBP increased the apoptotic cell population of neural stem cells at moderate low temperature. (PMID:20735994) This antibody can bind the close sequences genes. This antibody is a mouse monoclonal antibody raised against full length CIRBP of human origin.

Publications

SpeciesApplicationTitle

Front Pharmacol

Hypothermic Shock Applied After Perinatal Asphyxia Prevents Retinal Damage in Rats.

Authors - Manuel Rey-Funes

PLoS One

Cold Shock Proteins Are Expressed in the Retina Following Exposure to Low Temperatures.

Authors - Ignacio M Larrayoz
humanIHC

Ann Dermatol

Expression of Cold-Inducible RNA-Binding Protein in Normal Skin, Actinic Keratosis and Squamous Cell Carcinoma.

Authors - Bo Mi Park
Loading...
||
New chat Able
正在加载,请稍候...