Product Information
51008-2-AP targets ABCE1 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0454 Product name: Recombinant human ABCE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC016283 Sequence: MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA Predict reactive species |
Full Name | ATP-binding cassette, sub-family E (OABP), member 1 |
Calculated Molecular Weight | 599 aa, 67 kDa |
Observed Molecular Weight | 67 kDa |
GenBank Accession Number | BC016283 |
Gene Symbol | ABCE1 |
Gene ID (NCBI) | 6059 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61221 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |