Tested Applications
| Positive WB detected in | L02 cells, A549 cells, human lung tissue |
| Positive IHC detected in | human thyroid cancer tissue, human lung tissue, human prostate cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12319-2-AP targets ACAA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2972 Product name: Recombinant human ACAA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 117-424 aa of BC011977 Sequence: STVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN Predict reactive species |
| Full Name | acetyl-Coenzyme A acyltransferase 1 |
| Calculated Molecular Weight | 424 aa, 44 kDa |
| Observed Molecular Weight | 41 kDa |
| GenBank Accession Number | BC011977 |
| Gene Symbol | ACAA1 |
| Gene ID (NCBI) | 30 |
| RRID | AB_2289045 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09110 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACAA1 (acetyl-CoA acyltransferase 1) is an enzyme involved in lipid β-oxidation and provides substrates to the tricarboxylic acid (TCA) cycle, a critical step in cellular metabolism (PMID:33194642). ACAA1 is also a biomarker in type 2 diabetes (T2D), predicting the pre-diabetic metabolic signature in mouse models (PMID:25784953). Moreover, ACAA1 is highly expressed in TNBC, serving as a potential therapeutic target in ACAA1-high tumors and a predictive biomarker of resistance to CDK4/6 inhibitors for RB1-proficient patients (PMID:37129951).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACAA1 antibody 12319-2-AP | Download protocol |
| IHC protocol for ACAA1 antibody 12319-2-AP | Download protocol |
| WB protocol for ACAA1 antibody 12319-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACAA1 antibody (Cat# 12319-2-AP) has 26 citations published in journals including Nature, Nat Chem Biol, Adv Sci, EBioMedicine, Cell Mol Life Sci, Commun Biol, Int J Mol Sci, Sci Rep, FEBS Lett, Hum Mol Genet, Kidney360, Proteomics, and others. Research fields span peroxisome biology, lipid metabolism, liver fibrosis and steatosis, cancer (ferroptosis, pancreatic cancer), neurology/myelin integrity, metabolic disorders (Zellweger syndrome), hepatotoxicity, asthma, and lactation biology.
| Species | Application | Title |
|---|---|---|
Drug Resist Updat MYC expression and fatty acid oxidation in EGFR-TKI acquired resistance | ||
Nat Chem Biol The molecular glue CLEO4-88 inhibits the ACAA1 thiolase by induced binding to GID4. | ||
Adv Sci (Weinh) Erucic Acid, Derived by Lactobacillus Crispatus, Induces Ferroptosis in Cervical Cancer Organoids Through the PPAR-δ Signaling Pathway. | ||
Phytomedicine Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment | ||
EBioMedicine PPARγ maintains the metabolic heterogeneity and homeostasis of renal tubules. |
Reviews
What customers say
Users report strong performance across applications. For immunofluorescence on B16 melanoma cells at 1:100, one reviewer praised the staining quality with a 5-star rating. Two Western blot users also gave positive feedback: one observed clear bands on THP1 lysates at 1:250 (4 stars), noting bands appeared slightly below the predicted molecular weight; another achieved good results on Cos7 cells at 1:1000 with an overnight incubation at 4°C (5 stars). Overall, reviewers find this antibody reliable for both WB and IF.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yueming (Verified Customer) (10-02-2025) | Very good IF staining results
 |
PAULA (Verified Customer) (07-12-2023) | I tested this ACAA1 antibody on THP1 cells (20 ug total cell lysate) and two nice bands were observed at the most concentrated dilution (1:250), although they were located slightly below the predicted molecular weight.
 |
Tom (Verified Customer) (04-01-2022) | 1:1000 for 18 hours at 4 degrees
 |
