ACSM5 Polyclonal antibody

ACSM5 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16591-1-AP

Publications (3)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

ACSM 5, Acyl-CoA synthetase medium-chain family member 5, Acyl-coenzyme A synthetase ACSM5, mitochondrial, EC:6.2.1.2, MACS3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-P

WB analysis using 16591-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16591-1-AP (ACSM5 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16591-1-AP (ACSM5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16591-1-AP (ACSM5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16591-1-AP (ACSM5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16591-1-AP (ACSM5 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16591-1-AP (ACSM5 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16591-1-AP (ACSM5 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 16591-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16591-1-AP (ACSM5 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 16591-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using ACSM5 antibody (16591-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ACSM5 in ?

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse liver tissue
Positive IHC detected in	human liver cancer tissue, mouse liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse brain tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:16000
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16591-1-AP targets ACSM5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9373 Product name: Recombinant human ACSM5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC016703 Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR Predict reactive species
Full Name	acyl-CoA synthetase medium-chain family member 5
Calculated Molecular Weight	208 aa, 23 kDa
Observed Molecular Weight	65 kDa
GenBank Accession Number	BC016703
Gene Symbol	ACSM5
Gene ID (NCBI)	54988
RRID	AB_2878284
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q6NUN0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for ACSM5 antibody 16591-1-AP	Download protocol
IHC protocol for ACSM5 antibody 16591-1-AP	Download protocol
WB protocol for ACSM5 antibody 16591-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ACSM5 Polyclonal antibody (Cat# 16591-1-AP) has 3 total citations. These appear in JCI Insight, Molecular Metabolism, and bioRxiv. The cited research covers fatty acid oxidation disorders and exercise intolerance in mouse models, as well as metabolic reprogramming in kidney fibrosis. All citations used the antibody for Western blot applications in mouse samples.

Species	Application	Title
mouse	WB	JCI Insight Oral octanoylcarnitine alleviates exercise intolerance in mouse models of long-chain fatty acid oxidation disorders. Authors - Keaton J. Solo View Article
mouse	WB	Mol Metab Calponin 2 harnesses metabolic reprogramming to determine kidney fibrosis Authors - Yuan Gui View Article
mouse	WB	bioRxiv Oral octanoylcarnitine alleviates exercise intolerance in mouse models of long-chain fatty acid oxidation disorders Authors - Keaton J Solo View Article