Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24378-1-AP targets ACTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19479 Product name: Recombinant human ACTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species |
| Full Name | actinin, alpha 3 |
| Calculated Molecular Weight | 901 aa, 103 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC099647 |
| Gene Symbol | ACTN3 |
| Gene ID (NCBI) | 89 |
| RRID | AB_2879515 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08043 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha-actinin-3(ACTN3) is a member of the alpha-actin binding protein gene family. The members of this family are actin cross-linking proteins, among which ACTN2 and ACTN3 are muscle-specific subtypes. ACTN3 is primarily expressed in skeletal muscle and functions as a structural component of the sarcomeric Z line.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACTN3 antibody 24378-1-AP | Download protocol |
| IHC protocol for ACTN3 antibody 24378-1-AP | Download protocol |
| WB protocol for ACTN3 antibody 24378-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACTN3 polyclonal antibody (Cat# 24378-1-AP) has 3 total citations, all in WB applications. Citations appear in Cell Metabolism (liver fibrosis during overtraining), FASEB Journal (skeletal muscle contractile dysfunction), and Doklady of Biochemistry and Biophysics (muscle passive tension with hindlimb unloading). The research fields span muscle fibrosis, skeletal muscle physiology, and exercise-induced muscle pathology in mouse and rat models.
| Species | Application | Title |
|---|---|---|
Cell Metab Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining | ||
FASEB J Overexpression of enhanced yellow fluorescent protein fused with Channelrhodopsin-2 causes contractile dysfunction in skeletal muscle | ||
Dokl Biochem Biophys Early Deсline in Rat Soleus Passive Tension with Hindlimb Unloading: Inactivation of Cross-bridges or Activation of Calpains? |
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution. One user (5/5) reported excellent performance on A549 cells. The other (4/5) confirmed specific recognition of ACTN3 in MDCK cells but noted some weaker non-specific bands. Overall, the antibody is well-received for WB with good target specificity, though minor non-specific binding was observed in one case.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Edma (Verified Customer) (03-03-2025) | The antibody worked very well in western blot :)
 |
Joleen (Verified Customer) (06-12-2019) | The antibody recognizes ACTN3 (top band) but also other non-specific proteins, though less prominently.
 |
