Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue, human brain tissue |
| Positive IP detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13433-1-AP targets ACYP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4237 Product name: Recombinant human ACYP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC035568 Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK Predict reactive species |
| Full Name | acylphosphatase 1, erythrocyte (common) type |
| Calculated Molecular Weight | 99 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC035568 |
| Gene Symbol | ACYP1 |
| Gene ID (NCBI) | 97 |
| RRID | AB_2242288 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07311 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ACYP1 antibody 13433-1-AP | Download protocol |
| WB protocol for ACYP1 antibody 13433-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACYP1 Polyclonal antibody (Cat# 13433-1-AP) has 2 total citations. They appear in Drug Resistance Updates (IF 22) and International Immunopharmacology (IF 5.6). The research fields span hepatocellular carcinoma with lenvatinib resistance and glycolysis targeting, as well as esophageal squamous cell carcinoma involving the PKM2/STAT3/c-MYC signaling pathway. Both studies utilized human samples with WB, IP, and IHC applications.
| Species | Application | Title |
|---|---|---|
Drug Resist Updat Targeting ACYP1-mediated glycolysis reverses lenvatinib resistance and restricts hepatocellular carcinoma progression
| ||
Int Immunopharmacol Pterostilbene suppresses the growth of esophageal squamous cell carcinoma by inhibiting glycolysis and PKM2/STAT3/c-MYC signaling pathway |
