Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ADAM10 Polyclonal antibody

ADAM10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25900-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

ADAM 10, Disintegrin and metalloproteinase domain-containing protein 10, EC:3.4.24.81, KUZ, MADM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman pancreas cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25900-1-AP targets ADAM10 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23078

Product name: Recombinant human ADAM10 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 306-512 aa of BC126253

Sequence: EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV

Predict reactive species
Full Name ADAM metallopeptidase domain 10
Calculated Molecular Weight 748 aa, 84 kDa
Observed Molecular Weight 60-70 kDa, 90 kDa
GenBank Accession NumberBC126253
Gene Symbol ADAM10
Gene ID (NCBI) 102
RRIDAB_2880291
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14672
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAM10, a member of the ADAM (a disintegrin and metalloprotease) family, is widely expressed in the brain, the spinal cord, and the visual system during development.MW of premature ADAM10 is 90 kDa and mature ADAM10 is 60-70 kDa (PMID: 24404179).

Protocols

Product Specific Protocols
IHC protocol for ADAM10 antibody 25900-1-APDownload protocol
WB protocol for ADAM10 antibody 25900-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Aging Cell

Microglia-derived Galectin-9 drives amyloid-β pathology in Alzheimer's disease

Authors - Guoxin Zhang
humanWB,IF

Cell Death Dis

Cytoplasmic fragment of CD147 generated by regulated intramembrane proteolysis contributes to HCC by promoting autophagy.

Authors - Bo Wu
mouse,humanWB,IHC,IF

Pharmacol Res

IDO1 can impair NK cells function against non-small cell lung cancer by downregulation of NKG2D Ligand via ADAM10.

Authors - Xin Fang
humanWB

Cell Prolif

Increased SPON1 promotes pancreatic ductal adenocarcinoma progression by enhancing IL-6 trans-signalling.

Authors - Yanmiao Huo
mouseWB

J Neurosci

Novel Social Stimulation Ameliorates Memory Deficit in Alzheimer's Disease Model through Activating α-Secretase

Authors - Qiaoyun Ren
humanWB

Front Cell Dev Biol

NLGN3 Upregulates Expression of ADAM10 to Promote the Cleavage of NLGN3 via Activating the LYN Pathway in Human Gliomas.

Authors - Ning-Ning Dang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Angelique (Verified Customer) (02-03-2025)

used in western-blot (o/n 4°C 1/1000) on mouse livers and liver tumors. Strong signal, few non-specific band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: mouse livers
ADAM10 Antibody Western Blot validation (1/1000 dilution) in mouse livers (Cat no:25900-1-AP)

Xiaoyu (Verified Customer) (02-07-2024)

Good signal

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: brain
ADAM10 Antibody Western Blot validation (1:1000 dilution) in brain (Cat no:25900-1-AP)

David (Verified Customer) (09-02-2019)

Used for immunoblot at 1:1000 which gives good, clear bands at the expected molecular weight, but does require long exposure times (30µg total protein, 10-15 minutes exposure). 1:500 would probably be a better dilution and this will be used for future experiments. It can be difficult to obtain good ADAM10 antibodies, but after trying several, this is the best.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human neuroblastoma
Loading...
||
New chat

Able

正在加载,请稍候...