Tested Applications
| Positive WB detected in | BxPC-3 cells, mouse pancreas tissue |
| Positive IHC detected in | human tonsillitis tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23778-1-AP targets ADAM8 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17262 Product name: Recombinant human ADAM8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 145-494 aa of BC115404 Sequence: EGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQEN Predict reactive species |
| Full Name | ADAM metallopeptidase domain 8 |
| Calculated Molecular Weight | 824 aa, 89 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC115404 |
| Gene Symbol | ADAM8 |
| Gene ID (NCBI) | 101 |
| RRID | AB_2879321 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P78325 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADAMs are a large family of transmembrane proteins that are involved in proteolysis, making them candidates for mediating the remodeling of the extracellular matrix(ECM). ADAM8, one of the members of the ADAM family, is overexpressed in various human tumors. It has been shown previously that hypoxia influences the expression of some ADAM proteins. The protein found to be expressed in two active forms(90 kDa and 60 kDa): potential shedding protein and remnant protein in the pancreatic tissues under chronic pancreatitis and pancreatic cancer(PMID:18566576). The full length protein has a signal peptide and four glycosylation sites. This antibody is specific to ADAM8.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ADAM8 antibody 23778-1-AP | Download protocol |
| WB protocol for ADAM8 antibody 23778-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ADAM8 antibody (Cat# 23778-1-AP) has 15 citations spanning journals including Nature Medicine, Nature Communications, FASEB Journal, Experimental Neurology, Cancers, Scientific Reports, International Journal of Molecular Medicine, and others. Research fields covered include oncology (gastric, colorectal, glioblastoma, hepatocellular, and renal cancers), cardiovascular disease (myocardial infarction, cardiac fibrosis), neurology (stroke, ischemia-reperfusion injury), immunology, inflammation, and osteoarthritis. Applications include WB, IHC, and IP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Med Translation control of the immune checkpoint in cancer and its therapeutic targeting. | ||
Nat Commun Targeting cardiomyocyte ADAM10 ectodomain shedding promotes survival early after myocardial infarction | ||
Int J Mol Med ADAM17 promotes lymph node metastasis in gastric cancer via activation of the Notch and Wnt signaling pathways. | ||
Sci Rep Identification of a novel macrophage-related prognostic signature in colorectal cancer | ||
Cancers (Basel) The GBM Tumor Microenvironment as a Modulator of Therapy Response: ADAM8 Causes Tumor Infiltration of Tams through HB-EGF/EGFR-Mediated CCL2 Expression and Overcomes TMZ Chemosensitization in Glioblastoma | ||
Exp Neurol Roles of Adam8 in Neuroinflammation in experimental ischemic Stroke: Insights from single-cell and ribosome-bound mRNA sequencing |
Reviews
What customers say
One customer rated this antibody 4 out of 5 stars, using it for Western Blot on liver tissue at a 1:1000 dilution. They described it as a "good antibody for WB," indicating satisfactory performance in their application. The review was posted in October 2025 and references lot 00089073.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (10-24-2025) | GOOD ANTIBODY FOR WB
|
