Tested Applications
| Positive WB detected in | mouse placenta tissue, NIH/3T3 cells |
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24934-1-AP targets ADAMTS12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20712 Product name: Recombinant human ADAMTS12 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-229 aa of BC058841 Sequence: MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW Predict reactive species |
| Full Name | ADAM metallopeptidase with thrombospondin type 1 motif, 12 |
| Calculated Molecular Weight | 178 kDa |
| Observed Molecular Weight | 155 kDa |
| GenBank Accession Number | BC058841 |
| Gene Symbol | ADAMTS12 |
| Gene ID (NCBI) | 81792 |
| RRID | AB_2879806 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADAMTS12(A disintegrin and metalloproteinase with thrombospondin motifs 12) is also named as AT12, ADAM-TS12, PRO4389 and belongs to the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. ADAMTS7 and ADAMTS12 appear to be potent negative regulators of endplate cartilage development(PMID:22247065). This protein has 3 isoforms produced by alternative splicing. The full length protein has 14 glycosylation sites.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ADAMTS12 antibody 24934-1-AP | Download protocol |
| WB protocol for ADAMTS12 antibody 24934-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ADAMTS12 antibody (Cat# 24934-1-AP) has 13 citations published in journals including BMC Medicine, International Journal of Molecular Medicine, Molecular Medicine, Oncotarget, Scientific Reports, Cell Signaling, FASEB Journal, Hepatobiliary & Pancreatic Diseases International, Human Molecular Genetics, Discovery Oncology, Cell Physiology & Biochemistry, and In Vitro Cell & Developmental Biology. Research fields span gastric, pancreatic, breast, cervical, and glioma cancers, osteoarthritis, preterm birth, and neuropathies.
| Species | Application | Title |
|---|---|---|
BMC Med Genomic pathogenic alterations in the SWI/SNF complex compromise the outcomes of immunotherapy in Chinese patients with KRAS-mutant NSCLC by downregulating STING expression. | ||
Int J Mol Med Overexpression of PRDM13 inhibits glioma cells via Rho and GTP enzyme activation protein. | ||
Oncotarget Cleavage of Fibulin-2 by the aggrecanases ADAMTS-4 and ADAMTS-5 contributes to the tumorigenic potential of breast cancer cells. | ||
Sci Rep ADAMTS12 acts as a tumor microenvironment related cancer promoter in gastric cancer.
| ||
Cell Signal ADAMTS12 promotes oxaliplatin chemoresistance and angiogenesis in gastric cancer through VEGF upregulation |
Reviews
What customers say
One reviewer (rating 3/5) used this antibody for Western Blot on human samples and detected a band at the expected molecular weight. However, they noted that the band did not shift upon deglycosylation treatment, raising concerns about whether it truly represented the target protein. Overall, the feedback suggests the antibody works but may have specificity issues that warrant further validation.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (01-13-2026) | detected a band around the calculated molecular weight, but this band did not respond to deglycosylation treatment, which makes me doubt it is the actual band.
|
