Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 16 publications below |
| IHC | See 4 publications below |
| IF | See 6 publications below |
Product Information
13096-1-AP targets ADRB2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3715 Product name: Recombinant human ADRB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-413 aa of BC012481 Sequence: SRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL Predict reactive species |
| Full Name | adrenergic, beta-2-, receptor, surface |
| Calculated Molecular Weight | 46 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC012481 |
| Gene Symbol | ADRB2 |
| Gene ID (NCBI) | 154 |
| RRID | AB_2225401 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07550 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity and type 2 diabetes. This antibody detects ADRB2 with an apparent molecular weight of 50-55 kDa as has been shown by some researches (PMID: 25348166; 12502786; 29232706; 23984976; 19584355).
Publications
| Species | Application | Title |
|---|---|---|
Drug Des Devel Ther 10-Gingerol Enhances the Effect of Taxol in Triple-Negative Breast Cancer via Targeting ADRB2 Signaling
| ||
Proc Natl Acad Sci U S A Astrocytic β2-adrenergic receptors mediate hippocampal long-term memory consolidation. | ||
Diabetes Hepatokine ERAP1 Disturbs Skeletal Muscle Insulin Sensitivity via Inhibiting USP33-Mediated ADRB2 Deubiquitination. | ||
Mol Ther Nucleic Acids Translatome and Transcriptome Profiling of Hypoxic-Induced Rat Cardiomyocytes. | ||
Int J Mol Sci β-Adrenoceptor Activation in Breast MCF-10A Cells Induces a Pattern of Catecholamine Production Similar to that of Tumorigenic MCF-7 Cells. | ||
Int J Mol Sci Relation of Plasma Catecholamine Concentrations and Myocardial Mitochondrial Respiratory Activity in Anesthetized and Mechanically Ventilated, Cardiovascular Healthy Swine |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Elisa (Verified Customer) (04-14-2022) | It didn´t work. I used this antibody costained with a marker for microglia (Iba1) and a marker for neuron (neun). I tried two different protocols of immunofluorescence and one of them was with an antigen retrieval step. In both cases I didn´t have luck in obtaining a good result. You can see in the images that I attached.
![]() |
FH Tongbin (Verified Customer) (08-25-2020) | This antibody works beautifully in western blots.
|








