Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AIFM2/ FSP1 Polyclonal antibody

AIFM2/ FSP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

AIFM2, AMID, FSP1, AIFM 2, Apoptosis inducing factor 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AIFM2/ FSP1 in ?

Tested Applications

Positive WB detected inmouse kidney tissue, HeLa cells, rat liver tissue, HepG2 cells, PC-12 ceslls
Positive IP detected inL02 cells
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20886-1-AP targets AIFM2/ FSP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13412

Product name: Recombinant human AIFM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-373 aa of BC023601

Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

Predict reactive species
Full Name apoptosis-inducing factor, mitochondrion-associated, 2
Calculated Molecular Weight 41 kDa
Observed Molecular Weight41 kDa
GenBank Accession NumberBC023601
Gene Symbol AIFM2/ FSP1
Gene ID (NCBI) 84883
RRIDAB_2878756
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BRQ8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis-associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis-Inducing Factor), a mitochondrion-associated enzyme that relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Protocols

Product Specific Protocols
IF protocol for AIFM2/ FSP1 antibody 20886-1-APDownload protocol
IHC protocol for AIFM2/ FSP1 antibody 20886-1-APDownload protocol
IP protocol for AIFM2/ FSP1 antibody 20886-1-APDownload protocol
WB protocol for AIFM2/ FSP1 antibody 20886-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-FSP1 antibody (Cat# 20886-1-AP) has 307 total citations. Publications span top-tier journals including Nature, Science, Cell, Nature Communications, Nature Cell Biology, Cell Death & Disease, Autophagy, Redox Biology, and Molecular Cell, among many others. Key research fields include ferroptosis biology, oncology, neurodegeneration, liver fibrosis, acute kidney injury, cardiovascular disease, immunology, environmental toxicology, and cellular metabolism.

SpeciesApplicationTitle
mouseIHC

Signal Transduct Target Ther

CD147 contributes to SARS-CoV-2-induced pulmonary fibrosis

Authors - Jiao Wu
mouse,humanWB

Nature

Lymph node environment drives FSP1 targetability in metastasizing melanoma

Authors - Mario Palma
mouse,humanWB

Nature

Targeting FSP1 triggers ferroptosis in lung cancer.

Authors - Katherine Wu
  • KO Validated
humanWB

Nature

The CoQ oxidoreductase FSP1 acts parallel to GPX4 to inhibit ferroptosis.

Authors - Kirill Bersuker
mouseWB

Science

The origin of hepatocellular carcinoma depends on metabolic zonation.

Authors - Jason Guo
mouse,humanWB

Cell

Extracellular GPX4 impairs antitumor immunity via dendritic ZP3 receptors.

Authors - Jiao Liu

Reviews

    5.0 out of 5
Add a review

4 verified customer reviews

What customers say

All four reviewers gave this antibody a perfect 5-star rating for Western Blot applications. Users consistently praised its high specificity and reliable performance. One researcher highlighted its value in studying AIFM2/FSP1 expression related to ferroptosis in melanoma cell lines. Another noted it solved their long-standing difficulty in detecting this protein, calling the results "perfect." The antibody was used at a 1:1000 dilution across melanoma cells and cancer cell lines, with all reviewers reporting successful detection without issues.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Casey (Verified Customer) (11-30-2025)

Worked well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: melanoma cells

Haley (Verified Customer) (11-26-2025)

Highly specific

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cancer cell line

Jelan (Verified Customer) (10-31-2025)

For the protein AIFM2/FSP1, it itself is an inhibition of FSP1 sensitizes cancer cells to ferroptosis and suppresses tumor growth and it is associated with cell death. we use it in our western blots to see if our cell lysates from our experiment to see if they over or under express ferroptosis.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Melanoma cell lines

Selin (Verified Customer) (03-14-2024)

We've been having problems to identify this protein, but luckily this antibody worked perfectly.

  • Applications: Western Blot
Loading...
||
New chat

Able™

正在加载,请稍候...