Tested Applications
| Positive WB detected in | A549 cells, HepG2 cells, Jurkat cells, K-562 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:112-1:450 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11194-1-AP targets AKR1C3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1674 Product name: Recombinant human AKR1C3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC019230 Sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY Predict reactive species |
| Full Name | aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) |
| Calculated Molecular Weight | 323 aa, 37 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC019230 |
| Gene Symbol | AKR1C3 |
| Gene ID (NCBI) | 8644 |
| RRID | AB_2224414 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42330 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKR1C3(Aldo-keto reductase family 1 member C3) is also named as DDH1, HSD17B5, KIAA0119, PGFS and belongs to AKR1C family. .In humans, at least four AKR1C isoforms exist: AKR1C1, AKR1C2, AKR1C3, AKR1C4 and AKR1C3 shares >86% sequence identity with these three highly related human AKRs(PMID:18574251). It catalyzes the conversion of aldehydes and ketones to alcohols and androgen, estrogen, PG, xenobiotics metabolism. The rat kidney possesses a dimeric form of 75 kDa(PMID:18574251).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AKR1C3 antibody 11194-1-AP | Download protocol |
| IHC protocol for AKR1C3 antibody 11194-1-AP | Download protocol |
| IP protocol for AKR1C3 antibody 11194-1-AP | Download protocol |
| WB protocol for AKR1C3 antibody 11194-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
AKR1C3 antibody (Cat# 11194-1-AP) has 18 citations across 15 journals including Cell Metabolism, Journal of Experimental & Clinical Cancer Research, Molecular Cancer Therapeutics, World Journal of Gastroenterology, and Scientific Reports. Research fields span oncology (lung, colorectal, prostate, breast, bladder cancers), metabolic regulation (m6A methylation, retinoic acid metabolism), neurology (Parkinson's disease), hematologic malignancies (lymphoma, leukemia), and toxicology.
| Species | Application | Title |
|---|---|---|
Cell Metab m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 | ||
J Exp Clin Cancer Res Two-polarized roles of transcription factor FOSB in lung cancer progression and prognosis: dependent on p53 status | ||
Int J Mol Med 15-Deoxy-Δ(12,14)-prostaglandin J(2) induces growth inhibition, cell cycle arrest and apoptosis in human endometrial cancer cell lines. | ||
World J Gastroenterol Prostaglandin F2α synthase promotes oxaliplatin resistance in colorectal cancer through prostaglandin F2α-dependent and F2α-independent mechanism | ||
Mol Cancer Ther AKR1C3 promotes AR-V7 protein stabilization and confers resistance to AR-targeted therapies in advanced prostate cancer. | ||
Eur J Med Chem Development of highly potent and specific AKR1C3 inhibitors to restore the chemosensitivity of drug-resistant breast cancer |
