Tested Applications
| Positive WB detected in | A549 cells, human liver tissue, K-562 cells, HepG2 cells, mouse liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
22109-1-AP targets ALDH1A1-specific in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17358 Product name: Recombinant human ALDH1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 403-449 aa of BC001505 Sequence: GPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQA Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member A1 |
| Calculated Molecular Weight | 501 aa, 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC001505 |
| Gene Symbol | ALDH1A1 |
| Gene ID (NCBI) | 216 |
| RRID | AB_10949189 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00352 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001). This antibody can also recognize some other membranes of the aldehyde dehydrogenase family. This antibody is specific to ALDH1A1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALDH1A1-specific antibody 22109-1-AP | Download protocol |
| IHC protocol for ALDH1A1-specific antibody 22109-1-AP | Download protocol |
| WB protocol for ALDH1A1-specific antibody 22109-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Discov Transcriptional Silencing of ALDH2 Confers a Dependency on Fanconi Anemia Proteins in Acute Myeloid Leukemia. | ||
Cell Rep Med Distinctive multicellular immunosuppressive hubs confer different intervention strategies for left- and right-sided colon cancers | ||
Commun Biol PRMT3 interacts with ALDH1A1 and regulates gene-expression by inhibiting retinoic acid signaling. | ||
Neoplasma Long noncoding RNA ASAP1-IT1 promotes cancer stemness and predicts a poor prognosis in patients with bladder cancer. |











