Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse brain tissue, mouse testis tissue, rat brain tissue |
| Positive IHC detected in | human ovary tumor tissue, human colon cancer tissue, human liver tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
22220-1-AP targets ALDH1B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17557 Product name: Recombinant human ALDH1B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 330-382 aa of BC001619 Sequence: SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member B1 |
| Calculated Molecular Weight | 517 aa, 57 kDa |
| Observed Molecular Weight | 55-58 kDa |
| GenBank Accession Number | BC001619 |
| Gene Symbol | ALDH1B1 |
| Gene ID (NCBI) | 219 |
| RRID | AB_2879035 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30837 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112). This antibody is specific to ALDH1B1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALDH1B1 antibody 22220-1-AP | Download protocol |
| IHC protocol for ALDH1B1 antibody 22220-1-AP | Download protocol |
| WB protocol for ALDH1B1 antibody 22220-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oncotarget Proteomics and metabolomics analysis of hepatic mitochondrial metabolism in alcohol-preferring and non-preferring rats. | ||
Transl Cancer Res ALDH1B1 predicts poor survival for locally advanced nasopharyngeal carcinoma patients. |































