Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HL-60 cells, HeLa cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13073-1-AP targets ALOX15B in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3741 Product name: Recombinant human ALOX15B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC035217 Sequence: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKW Predict reactive species |
| Full Name | arachidonate 15-lipoxygenase, type B |
| Calculated Molecular Weight | 676 aa, 76 kDa |
| Observed Molecular Weight | 67-76 kDa |
| GenBank Accession Number | BC035217 |
| Gene Symbol | ALOX15B |
| Gene ID (NCBI) | 247 |
| RRID | AB_2227031 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In humans, there are 6 functional lipoxygenases genes. Two of them encode for arachidonic acid 12-lipoxygenating (ALOX12, ALOX12B) and two for 15-lipoxygenating enzymes (ALOX15, ALOX15B). ALOX15B has been described as the most abundant 15-lipoxygenating enzyme species in human carotid atherosclerotic lesions and to be associated with cerebrovascular symptoms. (PMID:24373925). ALOX15B has 4 isoforms produced by alternative splicing with the MW of 76, 67, 69 and 73 kDa. 13073-1-AP can also recognize the mouse Alox8 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ALOX15B antibody 13073-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
ALOX15B antibody (Cat# 13073-1-AP) has 13 citations across journals including Journal of Advanced Research, Redox Biology, Cell Death Discovery, Cell and Molecular Life Sciences, Life Sciences, Experimental Cell Research, Nutrition, Theriogenology, Discovery of Oncology, Journal of Chemical Neuroanatomy, Lipids in Health and Disease, Journal of Agricultural and Food Chemistry, and Neuroreport. Research fields span ferroptosis, lipid peroxidation, atherosclerosis, traumatic brain injury, sepsis-associated encephalopathy, spinal cord injury, hepatic steatosis, cardioprotection, and breast cancer.
| Species | Application | Title |
|---|---|---|
J Adv Res Modulation of Macrophage ferroptosis under the guide of infrared thermography promotes the healing of pressure injuries | ||
Redox Biol Excessive SOX8 reprograms energy and iron metabolism to prime hepatocellular carcinoma for ferroptosis | ||
Cell Death Discov Crizotinib and its enantiomer suppress ferroptosis by decreasing PE-O-PUFA content | ||
Lipids Health Dis Lipid peroxidation-induced ferroptosis as a therapeutic target for mitigating neuronal injury and inflammation in sepsis-associated encephalopathy: insights into the hippocampal PEBP-1/15-LOX/GPX4 pathway | ||
J Agric Food Chem β-Caryophyllene Confers Cardioprotection by Scavenging Radicals and Blocking Ferroptosis | ||
Cell Mol Life Sci Aminophylline targets miR-128-3p/Slc7a11 axis to attenuate neuronal ferroptosis after traumatic brain injury |
Reviews
What customers say
Two reviewers shared their experiences with this antibody. One user performed Western Blot at a 1:500 dilution and rated it 3 out of 5, noting the presence of some non-specific bands. Another user used it for Immunoprecipitation on monocytes at a 1:2500 dilution and gave it a full 5 out of 5 rating, mentioning that the antibody showed a slightly different band position compared to expected, and advised referring to the marker lane for accurate size determination. Overall, the antibody performs well for IP applications, while WB users may need to optimize conditions to reduce background.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nazek (Verified Customer) (08-07-2025) | some non-specific bands seen in the western blot
 |
Ankush (Verified Customer) (04-23-2024) | The antibody showed slightly different position. please refer to the marker lane
 |
