Use Able AI chat for product recommendations

Pancreatic alpha-amylase Monoclonal antibody

Pancreatic alpha-amylase Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66133-1-Ig
Clone No.2F1G8

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

AMY2A, Amylase Alpha, Amylase, alpha, AMY2B, AMY2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman saliva, tissue, pig pancreas tissue, rat pancreas tissue
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inBxPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:600-1:2400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66133-1-Ig targets Pancreatic alpha-amylase in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Cited Reactivityhuman, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8819

Product name: Recombinant human AMY2A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 162-511 aa of BC007060

Sequence: DIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Predict reactive species
Full Name amylase, alpha 2A (pancreatic)
Calculated Molecular Weight 511 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC007060
Gene Symbol Amylase Alpha
Gene ID (NCBI) 279
RRIDAB_2881532
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04746
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The complete human amylase gene contains five intact genes: two pancreatic genes (AMY2A and AMY2B) and three salivary genes (AMYIA, AMYIB, and AMYIC). AMY2A(Pancreatic alpha-amylase)is also named as PA and is a 56 kDa protein consisting of 496 amino acids in a single polypeptide chain, folded into three domains(PMID:10657258). It has a hydrolase activity acting on glycosyl bonds. AMY2A and AMY2B transcripts are present in the human pancreas but not in the parotid salivary gland, while AMY1 transcripts are present in the parotid gland but not in the pancreas(PMID:1692956).This antibody can recognize amylase alpha.

Protocols

Product Specific Protocols
IF protocol for Pancreatic alpha-amylase antibody 66133-1-IgDownload protocol
IHC protocol for Pancreatic alpha-amylase antibody 66133-1-IgDownload protocol
WB protocol for Pancreatic alpha-amylase antibody 66133-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
IF

Am J Physiol Gastrointest Liver Physiol

Is the intestinal mucous layer a NAtural Deep Eutectic Solvent (NADES) based digestion matrix

Authors - Theo A T G van Kempen
humanIHC

J Toxicol Pathol

Pancreatic Ductal Adenocarcinoma in a Wistar Hannover GALAS Rat.

Authors - Yusuke Kuroda

Eur J Pharmacol

Sirtuin 1 deacetylates NCOA4 to suppress ferritinophagy-mediated ferroptosis and ameliorate acute pancreatitis.

Authors - Zhao-Jian Shen
humanWB

J Proteome Res

Proteomic Analysis of Differences in the Freezability of Porcine Sperm Identifies α-Amylase As a Key Protein

Authors - Kejun Wang
pigIHC

Biochem Biophys Rep

Multiple cystic sphere formation from PK-8 cells in three-dimensional culture

Authors - Yuuki Shichi
humanIHC,IF

Stem Cell Res Ther

Emodin-Enhanced hUC-MSC extracellular vesicles alleviate acute pancreatitis by targeting inflammation and pyroptosis.

Authors - Xiong Liu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


balawant (Verified Customer) (06-23-2026)

We evaluated the amylase antibody for immunofluorescence staining at a dilution of 1:600 and obtained excellent results. The antibody produced strong and specific staining with minimal background signal, allowing clear visualization of amylase-positive cells.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:600
  • Cell Tissue Type: Mice colon sample
Loading...
||
New chat

Able

正在加载,请稍候...