APOBEC2 Polyclonal antibody

APOBEC2 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 20121-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

ARCD1, ARP1, C->U-editing enzyme APOBEC-2, EC:3.5.4.36, mRNA(cytosine(6666)) deaminase 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inmouse heart tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20121-1-AP targets APOBEC2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13699

Product name: Recombinant human APOBEC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-224 aa of BC047767

Sequence: MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK

Predict reactive species
Full Name apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC047767
Gene Symbol APOBEC2
Gene ID (NCBI) 10930
RRIDAB_10697687
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y235
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APOBEC2, also named as ARCD1 and ARP1, is a member of the activation-induced deaminase/apolipoprotein B mRNA editing enzyme catalytic polypeptide (APOBEC) cytidine deaminase family expressed in differentiated skeletal and cardiac muscle. APOBEC family members have diverse roles by their ability to edit DNA and/or RNA. Apobec2 is one of the oldest members of the APOBEC family, along with the lymphoid-specific activation-induced deaminase. Unlike other APOBEC family members, the enzymatic activity and substrate of Apobec2 have not been fully demonstrated, and its biologic functions remain unknown. It can be detected as 25-30 kDa.

Protocols

Product Specific Protocols
IHC protocol for APOBEC2 antibody 20121-1-APDownload protocol
IP protocol for APOBEC2 antibody 20121-1-APDownload protocol
WB protocol for APOBEC2 antibody 20121-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Int J Oncol

HBV triggers APOBEC2 expression through miR‑122 regulation and affects the proliferation of liver cancer cells.

Authors - Aimei Li

J Dermatol Sci

Proteomic changes related to actin cytoskeleton function in the skin of vildagliptin-treated mice

Authors - Antti Nätynki
Loading...
||
New chat Able
正在加载,请稍候...