Tested Applications
| Positive WB detected in | human plasma tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
Product Information
16530-1-AP targets APOC4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9780 Product name: Recombinant human APOC4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-127 aa of BC020723 Sequence: ACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG Predict reactive species |
| Full Name | apolipoprotein C-IV |
| Calculated Molecular Weight | 127 aa, 15 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC020723 |
| Gene Symbol | APOC4 |
| Gene ID (NCBI) | 346 |
| RRID | AB_2878271 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55056 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for APOC4 antibody 16530-1-AP | Download protocol |
| WB protocol for APOC4 antibody 16530-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med NEAT1/hsa-miR-372-3p axis participates in rapamycin-induced lipid metabolic disorder.
| ||
Mol Cell Proteomics Proteomic analysis of human follicular fluid-derived exosomes reveals that insufficient folliculogenesis in aging women is associated with infertility |



