Tested Applications
| Positive WB detected in | A375 cells, HepG2 cells, A2780 cells, human plasma, SW 1990 cells, A549 cells, SKOV-3 cells, HeLa cells, MCF-7 cells |
| Positive IP detected in | HepG2 cells, human plasma tissue |
| Positive IHC detected in | human kidney tissue, human liver tissue, human pancreas tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 6 publications below |
| IP | See 1 publications below |
Product Information
11486-2-AP targets APOL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, trypanosoma brucei |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2016 Product name: Recombinant human APOL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC017331 Sequence: MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA Predict reactive species |
| Full Name | apolipoprotein L, 1 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC017331 |
| Gene Symbol | APOL1 |
| Gene ID (NCBI) | 8542 |
| RRID | AB_2058396 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14791 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human apolipo-protein L1 (APOL1) is a minor component of plasma high density lipoprotein (HDL) particles, acting as an interacting protein of apolipoprotein A1 (ApoA1). The human ApoL protein family was thought to be predominantly involved in lipid transport and metabolism. APOL1 is also involved in host innate immunity against Trypanosoma parasites. Once activated, APOL1 can lyse the parasite and protect human from infection. Genetic variants in APOL1 gene, which are found in African ancestry with high frequency, associate with chronic kidney disease, like focal segmental glomerulosclerosis (FSGS), HIV-associated nephropathy (HIVAN), and hypertensive nephropathy. APOL1 share structural and functional similarities with proteins of the Bcl-2 family and may has roles in apoptosis and autophagy. It is notable that APOL1 exists only in human and a few other primate species, and mouse does not express an APOL1 orthologue. This antibody recognizes the endogenous APOL1 of 39-45 kDa in blood lysate.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for APOL1 antibody 11486-2-AP | Download protocol |
| IHC protocol for APOL1 antibody 11486-2-AP | Download protocol |
| IP protocol for APOL1 antibody 11486-2-AP | Download protocol |
| WB protocol for APOL1 antibody 11486-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Exp Med Distinct roles of apolipoprotein components within the trypanosome lytic factor complex revealed in a novel transgenic mouse model. | ||
Proc Natl Acad Sci U S A Hydrodynamic gene delivery of baboon trypanosome lytic factor eliminates both animal and human-infective African trypanosomes. | ||
J Am Soc Nephrol Apolipoprotein L1-Specific Antibodies Detect Endogenous APOL1 inside the Endoplasmic Reticulum and on the Plasma Membrane of Podocytes.
| ||
J Am Soc Nephrol Domain-Specific Antibodies Reveal Differences in the Membrane Topologies of Apolipoprotein L1 in Serum and Podocytes.
| ||
Br J Cancer A new panel of pancreatic cancer biomarkers discovered using a mass spectrometry-based pipeline. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH David (Verified Customer) (02-04-2023) | Good antibody for detect apol1 protein
![]() |






















































