• Featured Product
  • KD/KO Validated

APOL1 Polyclonal antibody

APOL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11486-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Apo-L, ApoL-I, Apolipoprotein L I, Apolipoprotein L-I

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, HepG2 cells, A2780 cells, human plasma, SW 1990 cells, A549 cells, SKOV-3 cells, HeLa cells, MCF-7 cells
Positive IP detected inHepG2 cells, human plasma tissue
Positive IHC detected inhuman kidney tissue, human liver tissue, human pancreas tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11486-2-AP targets APOL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, trypanosoma brucei
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2016

Product name: Recombinant human APOL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of BC017331

Sequence: MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA

Predict reactive species
Full Name apolipoprotein L, 1
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 39 kDa
GenBank Accession NumberBC017331
Gene Symbol APOL1
Gene ID (NCBI) 8542
RRIDAB_2058396
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14791
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human apolipo-protein L1 (APOL1) is a minor component of plasma high density lipoprotein (HDL) particles, acting as an interacting protein of apolipoprotein A1 (ApoA1). The human ApoL protein family was thought to be predominantly involved in lipid transport and metabolism. APOL1 is also involved in host innate immunity against Trypanosoma parasites. Once activated, APOL1 can lyse the parasite and protect human from infection. Genetic variants in APOL1 gene, which are found in African ancestry with high frequency, associate with chronic kidney disease, like focal segmental glomerulosclerosis (FSGS), HIV-associated nephropathy (HIVAN), and hypertensive nephropathy. APOL1 share structural and functional similarities with proteins of the Bcl-2 family and may has roles in apoptosis and autophagy. It is notable that APOL1 exists only in human and a few other primate species, and mouse does not express an APOL1 orthologue. This antibody recognizes the endogenous APOL1 of 39-45 kDa in blood lysate.

Protocols

Product Specific Protocols
IF protocol for APOL1 antibody 11486-2-APDownload protocol
IHC protocol for APOL1 antibody 11486-2-APDownload protocol
IP protocol for APOL1 antibody 11486-2-APDownload protocol
WB protocol for APOL1 antibody 11486-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Exp Med

Distinct roles of apolipoprotein components within the trypanosome lytic factor complex revealed in a novel transgenic mouse model.

Authors - Molina-Portela Maria Pilar MP
humanWB

Proc Natl Acad Sci U S A

Hydrodynamic gene delivery of baboon trypanosome lytic factor eliminates both animal and human-infective African trypanosomes.

Authors - Thomson Russell R
WB

Proc Natl Acad Sci U S A

Evolution of the primate trypanolytic factor APOL1.

Authors - Russell Thomson
humanWB,IF

J Am Soc Nephrol

Apolipoprotein L1-Specific Antibodies Detect Endogenous APOL1 inside the Endoplasmic Reticulum and on the Plasma Membrane of Podocytes.

Authors - Suzie J Scales
  • KO Validated
humanWB

J Am Soc Nephrol

Domain-Specific Antibodies Reveal Differences in the Membrane Topologies of Apolipoprotein L1 in Serum and Podocytes.

Authors - Nidhi Gupta
  • KD Validated
humanIHC

Br J Cancer

A new panel of pancreatic cancer biomarkers discovered using a mass spectrometry-based pipeline.

Authors - Xiaohui Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

David (Verified Customer) (02-04-2023)

Good antibody for detect apol1 protein

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1 to 200
  • Cell Tissue Type: 293T
APOL1 Antibody Immunofluorescence validation (1 to 200 dilution) in 293T (Cat no:11486-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...