Amphiregulin Monoclonal antibody

Amphiregulin Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66433-1-Ig
Clone No.1A1G9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig and More (1)

Applications

WB, IHC, IF, ELISA

AREG, 1A1G9, AR, AREGB, Colorectum cell-derived growth factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, rat brain tissue, MCF-7 cells, pig brain tissue
Positive IHC detected inhuman pancreas cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66433-1-Ig targets Amphiregulin in WB, IHC, IF, ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8907

Product name: Recombinant human AREG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-252 aa of BC009799

Sequence: AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Predict reactive species
Full Name amphiregulin
Calculated Molecular Weight 252 aa, 28 kDa
Observed Molecular Weight 50 kDa, 37 kDa
GenBank Accession NumberBC009799
Gene Symbol Amphiregulin/AREG
Gene ID (NCBI) 374
RRIDAB_2881803
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP15514
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Amphiregulin (AREG) is one of the ligands of the epidermal growth factor receptor (EGFR). AREG plays a central role in mammary gland development and branching morphogenesis in organs and is expressed both in physiological and in cancerous tissues. The AREG protein is synthesized as a 252-amino acid transmembrane precursor, pro-AREG. At the plasma membrane, pro-AREG is subjected to sequential proteolytic cleavages within its ectodomain and is then released as the soluble AREG protein. Depending on the cell type and microenvironment, AREG can be produced in multiple cellular and mature forms using alternative pro-AREG cleavage sites and glycosylation motifs. Post-translastional modfications of 50-kDa pro-AREG produces a major soluble 43-kDa form, 28-, 26-, 16-kDa membrane anchored forms, and soluble 21-, 19-, and 9-kDa forms (PMID: 9642297).

Protocols

Product Specific Protocols
IHC protocol for Amphiregulin antibody 66433-1-IgDownload protocol
WB protocol for Amphiregulin antibody 66433-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Rep Med

Tumor-associated monocytes promote mesenchymal transformation through EGFR signaling in glioma

Authors - Yiyun Chen
humanWB

J Invest Dermatol

LPCAT1 promotes cutaneous squamous cell carcinoma via EGFR-mediated AKT/p38MAPK signaling pathways.

Authors - Yingjian Huang
mouse

Cell Death Dis

TLR9 activation in large wound induces tissue repair and hair follicle regeneration via γδT cells

Authors - Xinhui Li
humanIF

Dev Cell

Morphogenesis and regeneration share a conserved core transition cell state program that controls lung epithelial cell fate

Authors - Xiangyi Ke

Int J Biol Sci

CD9 regulates keratinocyte migration by negatively modulating the sheddase activity of ADAM17.

Authors - Jie Liu
humanWB

Nat Commun

A single cell atlas of frozen shoulder capsule identifies features associated with inflammatory fibrosis resolution

Authors - Michael T H Ng
Loading...
||
New chat Able
正在加载,请稍候...