ARFIP2 Polyclonal antibody

ARFIP2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14548-1-AP

Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ADP-ribosylation factor-interacting protein 2, Arfaptin 2, Arfaptin-2, POR1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of HeLa using 14548-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 14548-1-AP (ARFIP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 14548-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 14548-1-AP (ARFIP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 14548-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 14548-1-AP (ARFIP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse pancreas using 14548-1-AP
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 14548-1-AP (ARFIP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human liver using 14548-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 14548-1-AP (ARFIP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human heart using 14548-1-AP
human heart tissue were subjected to SDS PAGE followed by western blot with 14548-1-AP (ARFIP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 14548-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14548-1-AP (ARFIP2 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 14548-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14548-1-AP (ARFIP2 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 14548-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14548-1-AP (ARFIP2 Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 14548-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14548-1-AP (ARFIP2 Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 14548-1-AP
Immunofluorescent analysis of Hela cells, using ARFIP2 antibody 14548-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 14548-1-AP
Immunofluorescent analysis of HepG2 cells, using ARFIP2 antibody 14548-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, human brain tissue, human heart tissue, human liver tissue, mouse pancreas tissue
Positive IHC detected in	human liver tissue, human pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	Hela cells, HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14548-1-AP targets ARFIP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag6076 Product name: Recombinant human ARFIP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 138-341 aa of BC000392 Sequence: RKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ Predict reactive species
Full Name	ADP-ribosylation factor interacting protein 2
Calculated Molecular Weight	38 kDa
Observed Molecular Weight	38 kDa, 45 kDa
GenBank Accession Number	BC000392
Gene Symbol	ARFIP2
Gene ID (NCBI)	23647
RRID	AB_2242930
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P53365
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for ARFIP2 antibody 14548-1-AP	Download protocol
IHC protocol for ARFIP2 antibody 14548-1-AP	Download protocol
WB protocol for ARFIP2 antibody 14548-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Cell Signal Deciphering the immunological and prognostic features of hepatocellular carcinoma through ADP-ribosylation-related genes analysis and identify potential therapeutic target ARFIP2 Authors - Fenfen Jiang View Article
mouse,human	WB,IHC,IF	J Hepatocell Carcinoma ARFIP2 Regulates EMT and Autophagy in Hepatocellular Carcinoma in Part Through the PI3K/Akt Signalling Pathway Authors - Kaida Huang View Article