×
Use Able AI chat for product recommendations

ARHGAP4 Polyclonal antibody

ARHGAP4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16697-1-AP
Publications(3)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KIAA0131, p115, RGC1, Rho GTPase-activating protein 4, Rho-GAP hematopoietic protein C1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using ARHGAP4 Polyclonal antibody (16697-1-AP)

    WB analysis using 16697-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 16697-1-AP (ARHGAP4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of HL-60 cells using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IP experiment of HL-60 using 16697-1-AP

    IP result of anti-ARHGAP4 (IP:16697-1-AP, 4ug; Detection:16697-1-AP 1:500) with HL-60 cells lysate 1000ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human lymphoma tissue using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IHC staining of human lymphoma using 16697-1-AP

    Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human lymphoma tissue using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IHC staining of human lymphoma using 16697-1-AP

    Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of mouse ovary tissue using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IHC staining of mouse ovary using 16697-1-AP

    Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of mouse ovary tissue using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IHC staining of mouse ovary using 16697-1-AP

    Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16697-1-AP (ARHGAP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of Jurkat cells using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IF Staining of Jurkat using 16697-1-AP

    Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ARHGAP4 antibody (16697-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of Jurkat cells using ARHGAP4 Polyclonal antibody (16697-1-AP)

    IF Staining of Jurkat using 16697-1-AP

    Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ARHGAP4 antibody (16697-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inHL-60 cells, Jurkat cells, K-562 cells, human placenta tissue, mouse spleen tissue
Positive IP detected inHL-60 cells
Positive IHC detected inhuman lymphoma tissue, mouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16697-1-AP targets ARHGAP4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10091

Product name: Recombinant human ARHGAP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 714-986 aa of BC052303

Sequence: VALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH

Predict reactive species
Full Name Rho GTPase activating protein 4
Calculated Molecular Weight 986 aa, 109 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC052303
Gene Symbol ARHGAP4
Gene ID (NCBI) 393
RRIDAB_1850892
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP98171
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for ARHGAP4 antibody 16697-1-APDownload protocol
IHC protocol for ARHGAP4 antibody 16697-1-APDownload protocol
IP protocol for ARHGAP4 antibody 16697-1-APDownload protocol
WB protocol for ARHGAP4 antibody 16697-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIHC

Front Oncol

Analysis of ARHGAP4 Expression With Colorectal Cancer Clinical Characteristics and Prognosis.

Authors - Ming-Sheng Fu
View Article
humanWB,IHC

Life Sci

Prognosis, immune microenvironment, and personalized treatment prediction in Rho GTPase-activating protein 4-mutant cervical cancer: Computer strategies for precision oncology

Authors - Xiaoqin Lu
View Article
humanIHC

Cancer Biomark

Rho GTPase-activating protein 4 is upregulated in Kidney Renal Clear Cell Carcinoma and associated with poor prognosis and immune infiltration

Authors - Xuesong Xiao
View Article
||
New chat

Able™

正在加载，请稍候...