Tested Applications
| Positive WB detected in | mouse testis tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25035-1-AP targets CDNF in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18972 Product name: Recombinant human ARMETL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-187 aa of BC133042 Sequence: MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL Predict reactive species |
| Full Name | arginine-rich, mutated in early stage tumors-like 1 |
| Calculated Molecular Weight | 187 aa, 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC133042 |
| Gene Symbol | ARMETL1 |
| Gene ID (NCBI) | 441549 |
| RRID | AB_2879861 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q49AH0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cerebral dopamine neurotrophic factor (CDNF) is a secreted protein belonging to the mesencephalic astrocyte-derived neurotrophic factor (MANF) family. Unlike classical neurotrophic factors, CDNF is primarily localized in the endoplasmic reticulum and exerts neuroprotective effects through modulating the unfolded protein response (UPR). CDNF has demonstrated potent protective effects on dopaminergic neurons in preclinical models of Parkinson's disease (PD), reducing neuroinflammation and alpha-synuclein aggregation. Its unique mechanism-targeting ER stress rather than receptor tyrosine kinases-offers a promising therapeutic avenue for neurodegenerative disorders. Clinical trials are currently evaluating recombinant human CDNF as a disease-modifying therapy for PD (PMID: 34284712; 37555005; 38290651).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDNF antibody 25035-1-AP | Download protocol |
| WB protocol for CDNF antibody 25035-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
